Fandom

Proteins Wiki

At2g02590.1/MSA

< At2g02590.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|49660103|gb|AAT68342.1|	   324 residues, 50 /line  hypothetical protein At2g02590 [Arabidopsis thaliana]
MAISTLLSISSFTLSSSS------------STKTHLLTSK--PASRVYSYPISPKWKQIR
FLQSQSSSLFY--PLRRNFTRFCSSPDGFL---RNTKDDEEGNEIIQLPSIGVNPVKFAI
CVVLWASFSLLWFARSG-----DAKAATDSIKSSSFGLRIASTLRRFGWPDEAV-VFALA
TLPVI----------------------------------------------ELRGAIPVG
Y--WMQLKPVVLTSFSVL-G-NMVPV----------------PFIVLYLKTFASFVAGK-
------------SQTASKLLD-ILFKRAKEK----AGPVEEFKW----LGLMLFVAVPFP
GTGAWTGAIIASILDMPFWSAVSSNFCGVVLAGLLVNLLVNLGL-----------KQAIV
AG--IALFFVST-----FMWSVLR----NIRKSIKPSLP
>gi|126178401|ref|YP_001046366.1|	   298 residues, 50 /line  hypothetical protein Memar_0451 [Methanoculleus marisnigri JR1]
----MLVPLGRSEE---------VLACVHHVVDRLPDRLRCPLHTLLDGRGVRCRLSLRC
RFLLRCGGGIDDPPPLFKATFSLAHMRG--------------------------------
---------------------------------------------CRSLWDKNL-AFLHR
PPPAGWMRRFIYPEDYRGYDMVRVAAIEACGRSLSPDTCRFRVARAVAFVLLFLLAVPLL
LGSAFGVSP--AAVLALI-G-STLLLQAAAAVVGLSLGMHPAAVLVFLTSVAAAVLVGIL
EIC-------DLFAGRSRMIQ-GLLSKIDAK-TGSIDYLKRYGA------LMLIPVIWIP
GIALYGTPVVAWVFQYPRAVSLLCMLAGWAIAIVVVMAATMGLVRL--------------
------------------------------------A-F
>gi|114320448|ref|YP_742131.1|	   150 residues, 50 /line  hypothetical protein Mlg_1292 [Alkalilimnicola ehrlichei MLHE-1]
------------------------------------------------------------
------------------------MSAV--------------------------------
---------------------------------------------VEPLWSYLL-VFLMA
ATPWV----------------------------------------------ELLVVIPLG
V--AMGLSPYGVALVALL-G-NALPV----------------VLIAVGWRTWQRWRGQP-
-----------------------RRALK----PRVQRVWNRWGL----PGLALLGPLV--
-TGIHLATVAALALRSSTRATAAWMVGSLVVWTLATTLVTVGGVAFY-------------
---------------QRMT------------------LW
>gi|121998645|ref|YP_001003432.1|	   144 residues, 50 /line  hypothetical protein Hhal_1866 [Halorhodospira halophila SL1]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MELLIKYTV-VFLLA
ATPWI----------------------------------------------ELMVVIPMG
A--AMGLSVTPLTIVAFI-G-NALPV----------------FAIIALFRWWEQRRGPV-
-----------------------QRRWS----ERATRVWDRYGL----PGLALLGPVL--
-TGIHLAAVMALALGAWRRQTAQWMVASLAVWAVVTGVVTAAGVEWL-------------
---------------TRSD--------------------
>gi|114565701|ref|YP_752855.1|	   151 residues, 50 /line  small multidrug export protein (QacE) [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------MEHSIFM-VIIAA
MTPVV----------------------------------------------ELRGAIPLG
L--ALGIPPAEVFLLSLI-G-NILPI----------------PFILLGIRWLLNEIKK--
---------------IPRLHN-WIDRKGKKGAGLLNEKIRRWGW----LGLMIFVAIPLP
GTGAWTGALAASFLSLKFWPSLLAIVGGVLIAGLLVTGASLGVISFL-------------
---------------------------------------
>gi|11499286|ref|NP_070524.1|	   137 residues, 50 /line  small multidrug export protein (qacE) [Archaeoglobus fulgidus DSM 4304]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-MPFS----------------------------------------------ELRGAIPLA
L--YFGFSPAEAYLLSVL-G-NILPV----------------PFLLLFLDYLVRIATK--
------------VELLARIYR-RVVERVERR----KGVVERYGY----LGLTIFVAIPLP
VTGAWTGTLLAFLLQLNRLKAFLFISAGVCIAGVVVLLASIGIIRLL-------------
---------------------------------------
>gi|116754816|ref|YP_843934.1|	   160 residues, 50 /line  putative small multi-drug export [Methanosaeta thermophila PT]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MIEIPEWAM-VMLLA
MSPIS----------------------------------------------ELRGAIPLA
I--ACGYSPLEAYAISVI-G-NLIPV----------------APLLLFLGPVSSFLMR--
------------YPPGYRFFT-WLFSRTRRK---YIEGREEVGF----AALTLFVAIPLP
VTGAWTGCVLAFLLGFRPLPAFLSIALGVLIAGVVVTAAVTGAFALC-------------
---------------HTI----------------QMS-I
>gi|124007804|ref|ZP_01692506.1|	   148 residues, 50 /line  hypothetical protein M23134_01701 [Microscilla marina ATCC 23134]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MELWLKYLS-VIAGS
MF-------------------------------------------------KFLFGPLIS
I--ANGLSFLESCVLTVI-G-MMISA----------------ILLSLLGEQIKKKIFNRY
FKPK------------------RLFTKNR---RRTVRIWRKYGL----AGVAFLTPVIFM
PIG---GPLIATYYGESWKRIVPYMFVSAIFWSPVTTGWVYFLGDMIQS-----------
-------------------------------------NA
>gi|124027469|ref|YP_001012789.1|	   154 residues, 50 /line  hypothetical membrane protein [Hyperthermus butylicus DSM 5456]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MPSTSVLT-AIVLG
LAPGF----------------------------------------------EPRYTLLL-
LAAMLGTAP--AIAIAVV-E-VVMLS-------------LALSLLVEKLEVLLERMGPR-
------------MPAAWLILE--RARRLA---EKHRGLVERYGA----LGLAAFVAIPLP
FTGMYTGSLVALILGFTRKERLVSLLAGGLASLVLVSTPLIAAENL--------------
--------------------------------------L
>gi|124485694|ref|YP_001030310.1|	   240 residues, 50 /line  hypothetical protein Mlab_0872 [Methanocorpusculum labreanum Z]
MNPDG--------ETGTALLYRILKRIFYLVVPILVYLVLLVVFWFV-------------
------------------------------------------------------------
-----YPPPTGVFTLPPSTEY----------------------------LALVG-LMGAY
LVPPF----------------------------------------------GKETIVPLA
L--GLGYPI-WVIFLGVV-GMDIVTA----------------TFVSLNFD----LLLK--
------------VPLIGRWIR-WVMRTADKV-RVSKPWIEQLSS----AGLLLFMYIPLQ
GSGSITCSVLGRLLGYKPAVSLGLVVIGSILSTLTVAIGASSVIQLWYINP-LLGVAAAL
AILAAILVIAYFWSR------------FTKRFYRSEG-V
>gi|124550198|ref|ZP_01707963.1|	   158 residues, 50 /line  conserved hypothetical protein [Shewanella putrefaciens 200]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MNDLLLYIS-VFVGA
AIPVL----------------------------------------------EVWIAVPLG
V--IAGLPWFPAALAGFF-G-NLLSL----------------LPIIYASEKVKLFMKR--
------------WRNKPETE-QVAHDIT----DRKHVIMEKFGV----PGLAFLGPFL--
-IGIHAAGAFAIAMGANRKVVMFWFTLSLLVCSLLFGFLASLGITQI-------------
---------------GEEKQ---------------LPFM
>gi|125588273|gb|EAZ28937.1|	   320 residues, 50 /line  hypothetical protein OsJ_012420 [Oryza sativa (japonica cultivar-group)]
MAAASVL--AASSSSSPP------------PLALASWRWRPPPPPPLLAVAGAARGATNP
RLALRLSAAAS--PPVTGESRAIAGTGRCLVAPMGGDETERDATAA------TAPD----
WGALARRLALGALGCAVLCCGGAAVAAEDSIKASGFGLRVAASLRRLGWADEAV-VFTLA
TLPVI----------------------------------------------ELRGAIPVG
Y--WMRLDPIRLTVLSVL-G-NMVPV----------------PFIILYLKKLAAFLSQR-
------------SASATRIMD-LLFERARQK----AAPVEEFQW----LGLMLFVAVPFP
GTGAWTGAIISSVLGMPFWSGFSANFVGVVLAGLLVNLLMNLGL-----------KYAII
TG--LVLFFLST-----VMWGVLR----SLKKSLNA--K
>gi|140044477|gb|ABE82708.2|	   313 residues, 50 /line  Putative small multi-drug export [Medicago truncatula]
MASSSALLLTPPFHFTKP------------HKKIPLFKHHSLKPKPSLTLHHGSSLLTH-
----SLTKIAP--TQFKASSTEYL---------DAIDEPERLIFYE------EKPVKFAL
WVIFWASMSLAWFAYSKDANAAAGTGAVDSIKASGFGLKIANSLRKLGWPDWVV-VFTLA
TLPVL----------------------------------------------ELRGAIPVG
Y--WLQLDPASLTVLSIL-G-NMVPV----------------PFIILYLKRFASFLASK-
------------SPSASRFLD-ILFKNAKAK----AGPVEEFQW----LGLMLFVAVPFP
GTGAWSGAIIASILDMPFWPAVSANFFGVVFAGMLVNLLVNLGL-----------KYAII
TG--IILFFVST-----FMWTILR----NLKKGFSSS-N
>gi|126180235|ref|YP_001048200.1|	   224 residues, 50 /line  hypothetical protein Memar_2295 [Methanoculleus marisnigri JR1]
-----MRQIDVWGDDG------DETSWLKVSVPFLLCGLFLAVVW---------------
------------------------FFLP--------------------------------
---------------------------------------------AEQWLLLLG-MMVAY
IVPPL----------------------------------------------GRETIIPVC
I--LCGIP-WWLTAFAL-AFLDFAGG----------------LFMAWN----FPLVLR--
------------IPHIGPRVS-RFTEAGRTF-LDRRPWLERLYF----VGLVAFVALPFD
GSGSIVGSVVGRVLGMTKTEVISCITIGGFIGSFAIALGIDYVVNLIPP-----GAGFWV
SLAVFLLIGAALLVTYR-----------SYSRRAETG-A
>gi|126466301|ref|YP_001041410.1|	   157 residues, 50 /line  small multidrug export protein (QacE) [Staphylothermus marinus F1]
------------------------------------------------------------
--------------------------MA--------------------------------
---------------------------------------------MNDLINILF-VILLA
ISPGI----------------------------------------------EARVAMPTA
V--LLGFDPFISFILSFV-A-SSIPA----------------VPLVYGLPWLEKTIIFR-
------------VGFLKNIYD-KIIERARSR----AHRISQYKI--VYLGLALYVAVPFP
LTGVWTGSLIAYILGLDRKKSTISIIFGNLIACTIIFSSIIAFTRI--------------
--------------------------------------I
>gi|126648692|ref|ZP_01721176.1|	   152 residues, 50 /line  hypothetical protein ALPR1_04603 [Algoriphagus sp. PR1]
------------------------------------------------------------
---------------------------M--------------------------------
---------------------------------------------SESLIKFLG-IYFLS
LFKFI-------------------------------------------------AGPVLG
S--AAGYGVLGSIFVTVA-G-MMTSV----------------LLFTLVGNKFKEYLKLRF
SKDK------------------PIFSKKN---RRLVSLWKKYGE----IGIAIITPLVLT
PIG---GTLIMVSFGAKKRHIYLNMLFSALFWASIFSLSIDQILEI--------------
----------PLFQN--------------------LL-R
>gi|126698568|ref|YP_001087465.1|	   154 residues, 50 /line  hypothetical protein CD0984 [Clostridium difficile 630]
--------------------------------------------M---------------
------------------------SLRI--------------------------------
---------------------------------------------GGNSLGYLH-ILILS
MVPVT----------------------------------------------ELRGAIPIG
I--AMGLNPIWVYVFSVI-G-STLVS----------------IPLILTFRHVLQFLRG--
------------KKLFKGIAD-VIDRKINSR----MKKLKSVSI----IGIILFVGIPLP
TTGTWTASAIASILKMRIKDAFMGVFLGNLLSGVIVSALSLHII----------------
---------------------------------------
>gi|14591427|ref|NP_143507.1|	   159 residues, 50 /line  hypothetical protein PH1658 [Pyrococcus horikoshii OT3]
------------------------------------------------------------
--------------------------ME--------------------------------
---------------------------------------------EDEGMKFVE-ILLLS
LVPTF----------------------------------------------EGRYAIIYG
L--AKGYPMLETLSASVL-G-VLILS-------------ITLPKLLPVIDVIMDKLKGTG
------------LKPFADLYT-SYLERTR---KKAKPYVERWGF----LGLMIFVAIPLP
GTGIWTGALASYLLGISERASIPALLIGGLLSVMITAFPAIGYLK---------------
--------------------------------------I
>gi|18978147|ref|NP_579504.1|	   151 residues, 50 /line  putative small multidrug export protein [Pyrococcus furiosus DSM 3638]
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------MSFLE-VFVMS
LIPTF----------------------------------------------EGRYAVVYG
I--QRGYGIFESIMAAIL-G-VIILS-------------LVLPYALPYIDKIMELLMSTP
------------LGKISKLYI-YYLERTR---KKASPYVKKWGF----LGLVVFVAIPLP
GTGIWTGSLAAYVLGIDKKSTIPALLIGGLLSLAITTLPTISL-----------------
--------------------------------------H
>gi|14601151|ref|NP_147679.1|	   143 residues, 50 /line  hypothetical protein APE_1041 [Aeropyrum pernix K1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----M----------------------------------------------EPRYALLVG
L--GLGLGLLESLALSAA-G-VLVLG----------------LLLYTAIDTVDRLMEALC
SRKRLG------VNPGCIYL--ALRSSAA---RRAGGYVERYGW----AGLIVFIAIPLP
ATGMYSGALAAALLGIRGPRLLASLLLGGYLSLAITAVVGGGV-AVV-------------
------------------------------------S-T
>gi|147669239|ref|YP_001214057.1|	   162 residues, 50 /line  hypothetical protein DehaBAV1_0594 [Dehalococcoides sp. BAV1]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------MFFQ----IIGVF
LLALV----------------------------------------------EIWLAIPIG
L--IWGLDPWLVILLVIG-G-TLVGV----------------GIIILLAERVRSGSNRWL
DKNRTGDATLSLSSLFAQIIS-ALQERLHS--GRLYKVWLKYGI----IGLGILSPVL--
-TSAPIAAFLGVMLSADRLKLFIWISVGVAVWTTGLTLAMHFGLILL-------------
------------------------------------G-I
>gi|148378769|ref|YP_001253310.1|	   154 residues, 50 /line  membrane protein [Clostridium botulinum A str. ATCC 3502]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MTKYAI-VFFMS
MVPIV----------------------------------------------ELRGAIPYS
Q--ALHLPVLQSFIVAII-G-NMLPM----------------PFIYLFARKVLVWGSD--
------------KPITGKFFT-WCLEKGEKA---GKKLQEKTGKKGLFWALLIFVAIPAP
GTGAWTGTLAASLLDMDFKTSILAVMLGVLVAGIIMGTASVGLFSF--------------
--------------------------------------F
>gi|22537969|ref|NP_688820.1|	   153 residues, 50 /line  hypothetical protein SAG1830 [Streptococcus agalactiae 2603V/R]
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------MNYII-TFLIS
MIPLV----------------------------------------------ELRGAVPFA
I--ANGIPLWEALAIGVV-G-NMLPV----------------PIIFFFARKVLEWGAD--
------------KPYTGKFFT-WCLKKGHSG---GQKLEKVAGEKGLFIALLLFVGIPLP
GTGAWTGTLAASLLDWEFKHSVIAVMLGVILAGCIMGTLSIIGFNL--------------
--------------------------------------F
>gi|15613797|ref|NP_242100.1|	   134 residues, 50 /line  small multidrug export related protein [Bacillus halodurans C-125]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-MPIV----------------------------------------------ELRGGIPLG
V--VLGLSPWEALLFGII-G-NLLPI----------------VPILLLFRPISGWMLR--
------------FKWYQRLYD-WLYNRTMK----KSNNVEKFGA----IGLILFTAVPLP
TTGAYSACLAAVLFFIPFRFAFFAVSAGVVIAGIVMTLFSYIL-----------------
--------------------------------------V
>gi|15613875|ref|NP_242178.1|	   152 residues, 50 /line  hypothetical protein BH1312 [Bacillus halodurans C-125]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MMTLWEYVL-IFLAA
ATPWL----------------------------------------------EAIVVVPLG
I--IRGLNPWLVSVVAFI-G-NWLTI----------------LLVIIFYEKFQAWREK--
------------RRIQKGIETPPESKRQ----KRARHIWNRYGL----PGLALGGPLV--
-IGTHLSALMALAFRSPKYLVTGWITFSLALWIVVFAVGAFYGFSWF-------------
------------------------------------Q-R
>gi|23097770|ref|NP_691236.1|	   144 residues, 50 /line  hypothetical protein OB0315 [Oceanobacillus iheyensis HTE831]
------------------------------------------------------------
---------------------------M--------------------------------
---------------------------------------------LEYIILAAT-AWFMG
FFPLF----------------------------------------------EIYLAIPAS
M--GLGLDMVSSIIWAWF-G-NFFAI----------------PFIAYSYDWLTK------
------------FNKINKYF----YKLTQS---KTSQRLNKGGF----M----IILLGTP
LLGSWAIGVIGKVIGMDKKRLFLSSAISIGIYGILIGVLTKLGIDLF-------------
--------------------------------------S
>gi|28212098|ref|NP_783042.1|	   151 residues, 50 /line  putative small multi-drug export protein [Clostridium tetani E88]
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------MELLK-VFLMS
AVPIV----------------------------------------------EQRGAIPMG
IF-MYNINPVLVCIVSFL-G-SLLPV----------------PFILLLFNSIFKWMKK--
------------YKIFDPLNN-IIENKIR----KNTGKLEKYKE----IGLIIFVGIPLP
TTGLWTGSAVAAFMGLDFKKSFLCAVVGGLISAIVITGACIIFPAFI-------------
------------------------------------P-H
>gi|51892150|ref|YP_074841.1|	   173 residues, 50 /line  small multi-drug export protein [Symbiobacterium thermophilum IAM 14863]
MFVTRLRRADTANPGGFL------------------------------------------
------------------------------------------------------------
---------------------------------------------VFNWSAALK-VMAIS
AIPFL----------------------------------------------ELRFGIPVG
I--VSGLDPAVAVALGVL-G-NVLQV----------------PLIIFIMYMLRRIAQL--
------------VPWAARILA-RIDRAA----ERHEAKVRRYGW----LGLALLIGIPIP
GTGLWTGAAVANLMRMPLMLTALSMAAGVAIAGVLVGAVTTGAIAVI-------------
---------------DL---------------------F
>gi|52079805|ref|YP_078596.1|	   166 residues, 50 /line  putative DNA binding protein [Bacillus licheniformis ATCC 14580]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MDMMWGYVL-VFILA
AIPWF----------------------------------------------EVIGVVPLA
I--IAGLKPVPSAIIALF-G-NLLTV----------------LLLIFLIDKVKVWLER--
------------RRGERRAETDKFSKRK----SRAKKIWLTYGI----PGLSFVGPFF--
-IGSHLTAFMCMGFGAKRRQTALWMTGSLAVWTTASAVAAYYGFSFL-------------
---------------APENEGLLK------NIFKQE--E
>gi|52550090|gb|AAU83939.1|	   198 residues, 50 /line  hypothetical protein GZ35A2_14 [uncultured archaeon GZfos35A2]
MELNAKVNIGRVLQMNKLAI-------AKFVIPFCLAGAAGVSFW---------------
------------------------LFTK--------------------------------
---------------------------------------------PEVYATYAAVLTTYF
FMPLF----------------------------------------------GTEAAIFAA
LHPNIGIPLPPAAVIAFMVFVDATLS----------------LFLVWN----LDYAKK--
------------IPYLGKLVE-WTEAKGEKA-LRKYKWAKRLGF----VGLTAFVMIPFQ
YTGAAVGSIAGRILGMTSLMTWLAVILGSFLRSTLITLVYIGVLSF--------------
--------------------------------------L
>gi|55980523|ref|YP_143820.1|	   156 residues, 50 /line  small multidrug export protein [Thermus thermophilus HB8]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MPFPPEVY-VLLVA
ALPVV----------------------------------------------ELRGAIPLG
V--ALGLSPWESFLWALL-G-NLLVV----------------PLALGLFPWAVGLATR--
------------VPLFARAWW-ALEARVRL---KGEAQVQRLGA----LGLFLFVAVPLP
GTGAWSGAVLAVVLGVRRRYAFPALALGVVAAGLLVLLLTGGTVH---------------
--------GLNYL-------------------------R
>gi|56750867|ref|YP_171568.1|	   166 residues, 50 /line  hypothetical protein syc0858_c [Synechococcus elongatus PCC 6301]
------------------------------------------------------------
-------------------------MMM--------------------------------
---------------------------------------------LERPWSELL-VMLMG
ATPLI----------------------------------------------ELRGAIPLG
L--ALNLNLGTSLIFALI-G-NSLVI----------------PIVLLLLPRIIQWCEG--
------------WPPFERFWE-ALERRVRL---KGEATVQRYGA----IGLGIFVAIPLP
GTGAWAGAALAVILGIRRRYALPSIGFGVLTAGILVALIAGGVLA---------------
--------GFQGLVL------------------KEIS-L
>gi|56962194|ref|YP_173917.1|	   162 residues, 50 /line  hypothetical protein ABC0414 [Bacillus clausii KSM-K16]
-----------------------MLQDLMK------------------------------
------------------------FIIE--------------------------------
---------------------------------------------ADTIYQYIG-VFIVS
LIPFF----------------------------------------------ESYVAIPIG
I--VLNFPVIPVVLLSIA-G-NLLSV----------------YVFIWLVDKLRR------
---------------TKKSTK-NEGSRR----KRALRFFQRYGV----PGVSFAGP----
IICFHVGAAIALGAGTSRQYVTLWQTIAIVVWSVALGIAFAFGVNLF-------------
---------------DYFPSL-------------NVF-S
>gi|56964662|ref|YP_176393.1|	   157 residues, 50 /line  hypothetical protein ABC2898 [Bacillus clausii KSM-K16]
MEAD--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------GLWLSL-LFVAS
MIPFI----------------------------------------------EYTLAVPVG
IL-FVNQPPVLTVLVSIL-G-NSLGV----------------VLLVLLSEKIRDWTLK--
------------RQNSQKSGR-QSSKQQ----EKTKHFLEKYGM----PGVGILAPILL-
--SSHIGAVTAVALGVSRSYAILWTLIGVVLWAIIFGIICVYASHWL-------------
------------LPF--------------------FG-Q
>gi|62423775|ref|ZP_00378932.1|	   159 residues, 50 /line  COG1238: Predicted membrane protein [Brevibacterium linens BL2]
-----------------------MIESIQN------------------------------
------------------------FADS--------------------------------
---------------------------------------------FPDWLQWAG-VLLVS
AIPFV----------------------------------------------ESYFGAVIG
V--AIGLHPVVAILVAVI-G-NVISM----------------LAFVYGAGAIRDKATKN-
----------------KDKDA-EPSQKR----QRLKRMFDKFGV----PGVSLLGQTLLP
---SQITSMAMVGFGANRNIVAFWQIISIILWGVLFGVLATLGIELA-------------
------------------------------------L-R
>gi|70606799|ref|YP_255669.1|	   142 residues, 50 /line  hypothetical protein Saci_1019 [Sulfolobus acidocaldarius DSM 639]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MELLKLLI-VGLTA
ASPVG----------------------------------------------ELLVAYPIG
L--AIGLDPLIAIITCSA-F-NLLPI----------------PILLSFAEYISNR-----
---------------FPKFFN-WIASKGKT----YEKYIKSFGI----TIFLLLT----P
IIGVYATSIFMFLIGFKKRIAFLVQALSICIYSVILYLASLGFLSIR-------------
--------------------------------------F
>gi|73669095|ref|YP_305110.1|	   170 residues, 50 /line  putative small multi-drug export protein [Methanosarcina barkeri str. fusaro]
------------------------MSIEIS------------------------------
------------------------LVEM--------------------------------
---------------------------------------------LGSVPHWLA-VLIMG
AIPVS----------------------------------------------ELRGAIPVA
MG-IYGMGPFEAFFFSVL-G-NLLPV----------------IPLLLFLEPVSNYLRR--
------------YSIFDTFFT-WLFSKTRRK---NTKNFEKYGL----FALTIFVAIPLP
VTGAWSGCAAAFVFGVKFRHALPAIAAGVMIAGIIVTGVTVTGLGLA-------------
---------------DLIL-----------------G-A
>gi|89210745|ref|ZP_01189130.1|	   158 residues, 50 /line  Putative small multi-drug export [Halothermothrix orenii H 168]
MNE------------VFLWLDKY-------------------------------------
------------------------------------------------------------
------------------------------------------------LSRELA-VLITA
CLPFI----------------------------------------------ELRGAIPLA
I--SLGFSPIKAFWLGII-G-NAIPV----------------IPLLVLLEPVRKWLRRR-
------------FRFMNKFFS-WLDERTLK----KSDKVDKYGA----LGLILFTAVPLP
TTGAWTASLAAILFKIKFRYAFPAIMVGILLAGCVVTLMSSVF-----------------
--------------------------------------L
>gi|88854876|ref|ZP_01129542.1|	   157 residues, 50 /line  hypothetical protein A20C1_08433 [marine actinobacterium PHSC20C1]
-----------------------MYDTLSN------------------------------
------------------------FTSG--------------------------------
---------------------------------------------LPELLQWVG-VMLAA
AIPFV----------------------------------------------ESYGGSVIG
V--ILGINPVVVIVAAII-G-NVVSM----------------LIFVLSAHGVRSKVTGR-
-----------------SEPK-PESARR----EKLRARFDRYGV----AGVSLLGQTILP
---SQITSAAMVSFGASKNAVILWQTISIIIWGVAFGVLATFGITIL-------------
--------------------------------------R
>gi|73748559|ref|YP_307798.1|	   175 residues, 50 /line  putative small multi-drug export protein [Dehalococcoides sp. CBDB1]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MGLPPELL-VFLAA
VLPVS----------------------------------------------ELRGALPLA
IN-VLGIPWYWAYLIALA-G-NLLPI----------------PVILVLLEKVLNLLERF-
-------------SFMRGFTR-WIYALGQR----RSTPVEKYKR----IGLMMLVAVPLP
VTGAWTGSLVAVVLGLNYKEALIYISLGVAIAGVIVTSLCLLGW-----------FGAIL
AG--GVLGGIGVYRIIH------------SKNR---P-L
>gi|126178471|ref|YP_001046436.1|	   238 residues, 50 /line  hypothetical protein Memar_0521 [Methanoculleus marisnigri JR1]
MSADDTTNIPRPEGYKALLANPYLTGPIKFVLPIVIALAIFAALY---------------
------------------------LIEP--------------------------------
---------------------------------------------YQQFLVISG-LLAAY
FVPPA----------------------------------------------GKESIIPIA
I--VMGYP-WWLVTLAIF-LLDVAVS----------------LFVVWN----FDLALKI-
-------------PLIGRVLE-SGMTAGRNY-TDARPWIRRFST----IGLVLFVFFPLQ
GTGAMNGAIVGRLLGLEKARVFACVCTGSLASSLIIAFGSDVLLDVYQQNH-ALGIGILA
AIVVAVLAAVAGLKLR------------EKRLRERSP-R
>gi|38049256|gb|AAR10427.1|	   147 residues, 50 /line  putative multidrug efflux transporter [Enterococcus faecium]
----------------------------MEIIKYI-------------------------
------------------------------------------------------------
-------------------------------------------------GAAFS-TWFIG
FFPYF----------------------------------------------EIYIAIPAG
F--AAGLNWFDAFLWASL-G-NWMVI----------------PFVDICYEWL----MKF-
-------------NFMKKIME-KSLNG------KWENRIEKHGA----WVILLL----TP
LAGVWTIGVIAKALKFNRAKLWIYSATSVGITGLIITILIINGITLN-------------
------------------------------------N-S
>gi|76796468|ref|ZP_00778829.1|	   162 residues, 50 /line  Putative small multi-drug export [Thermoanaerobacter ethanolicus ATCC 33223]
-----------------------MESFVKEILNFL-------------------------
------------------------------------------------------------
-------------------------------------------------PRELA-VLFIA
ALPVI----------------------------------------------ELRGAIPIG
I--SLGLSPFYTTIISLI-G-SMIPA----------------PFILFTIKPIFVRLKKT-
-------------RLFKKLVD-KLTDRSLKY---NGEKIQKYGV----WGLVLVVAIPLP
GTGVWSGSLAAALLNMQFKQALSAIFIGNIIAAILVMILSYGVGSLF-------------
--------------------------------------F
>gi|88602224|ref|YP_502402.1|	   248 residues, 50 /line  hypothetical protein Mhun_0933 [Methanospirillum hungatei JF-1]
---MDIKPLGCYISGGLIWFSPVINRVLRLTIPFLLTGVLIGVLF---------------
------------------------WLYD--------------------------------
---------------------------------------------DTTALQLGG-LLLLY
FVPPA----------------------------------------------GKESIIPAG
I--ALGF-PFQIMCLSIF-WVDIACC----------------LFMIWN----FELICNV-
-------------PYLGNIIR-YLIRKGELY-LGKHRWLEQLYF----IGLIFFVFFPLQ
GTGSVSGSVIGKMIGLKSIEIFAAIAIGSFLSSFLIGYSVYALHEYLDVNVWYVLIAVMF
IIIILPLLSYGFYKTKTGSKVCSWISGCVHKCRQSFN-K
>gi|148271574|ref|YP_001221135.1|	   155 residues, 50 /line  hypothetical protein CMM_0395 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
-----------------------MIDALQD------------------------------
------------------------FTNG--------------------------------
---------------------------------------------LPEVLRWFG-VMVTA
MIPFL----------------------------------------------EVEFAAVLG
V--ISGQHVAIAVLAAVV-G-NVAVV----------------ALIVLVASRTRS----R-
--------------LTRDSAK-EETPRR----AKIRRTFDRYGV----PGVSLLGPLL--
VGVTAFA-G-NLILV----------------LLLGFFFKQYAKWQAAR-
--------------KQKKGIT-TPSKKE----TRSRKIWDRYGI----PGLALLAPIL--
-VGTDIAAVLALTFGSNRTHVISWMTVSLAVWTVIFTVAAMYGLSFL-------------
---------------NI---------------------I
>gi|89096146|ref|ZP_01169039.1|	   176 residues, 50 /line  hypothetical protein B14911_25655 [Bacillus sp. NRRL B-14911]
--------------------------MMIE------------------------------
------------------------WAQS--------------------------------
---------------------------------------------ASAFWQYVV-IFIFS
AAPWM----------------------------------------------DISIVVPLG
V--LWGLSPFWTGVLAFA-G-NLLLL----------------ILLAIFFEQFFQWRNRR-
--------------REKKGAA-GPTKRD----KRSQQLWEKYGI----PGLALLAPLL--
-VGTDIAAVAAFSLGASRSRVLAWMTVSLAMWTIVFAAASAYGVSLL-------------
---------------DFTQEALLVSPPAVLP---GNA-S
>gi|126647858|ref|ZP_01720363.1|	   150 residues, 50 /line  putative small multi-drug export protein [Algoriphagus sp. PR1]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------MILDLLT-AMLWS
MSPFG----------------------------------------------EAKVGIPYA
L--FNGVNIYLALIFSFL-A-NLLVF----------------PFMNFFFDKANRYFLKW-
-------------YYYKKAAL-FVGRRAK---AGAGKNVEKYGF----WGLIFFVALPVP
GTGVYAGSIAGYLFGLDRKKAFYANAIGILISCLIVWAATLTAMKI--------------
---------------------------------------
>gi|88711764|ref|ZP_01105852.1|	   144 residues, 50 /line  putative small multidrug export protein [Flavobacteriales bacterium HTCC2170]
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MLWS
LSPFG----------------------------------------------EAKVGIPYG
M--YNGLNIYWVFAVCFL-S-NLLVF----------------PLMIFFLEKINRHFIKW-
-------------SLYKKIAI-YVARRAK---LGSGNKIQKFGF----LGLVFFVMIPLP
GTGVYAGSIATYLFRIEKQKAFIANAIGIFFSSVIIWTTTLLSMKS--------------
-------------------------------------FV

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.