FANDOM


>gi|18395372|ref|NP_565285.1|	   1218 residues, 50 /line  STI (STICHEL); ATP binding / DNA-directed DNA polymerase [Arabidopsis thaliana]
-----MSGSR----------VSDLSKLHL-------------------------------
--------------------------------------------------------KKEL
TQIRK-AGRVLRDPGTTSSWKSPLDSSRSVALLETPASR-----------NGGSSSQF--
-PIRGESSTNRR-----GKEKKVFLYNWKTQKSS--SEKSGLAKNGKEEEEEEEDASSWT
QASVN----DD-----DDVSDARNGGDSYRREIQSASMGFRC---------RDTNLASQG
-----------VSKMRKSNVGSCKKKSKKKISSSRLDCLSKYQPRDDIVAR--NCNAGSD
DTEEELSNSEDLR-------KVTGASPLLLKLKQKNWSRSSSRL------LRANNRKED-
SSCTYNSTPALS--------------------------------------------TS--
SYNMYAVRNPSTVGSWD------GTTTSVNDGDDEL-DDNLDLPGRQGCGIPCYWTKKAM
-KHRG------GCRSCCSPSF-----SDTLRRTGSSILCGSQSVYRRH-NRHSSGGYSKQ
--KIACRSAQGVLPLLSYGGD-GRGGSSLGTGLSDDELSTNYGELDLEAQSRLDGRRWST
-SYRSQD-GLEAVALDGE-EEEGSTPETIRSFSQKYRPMFFEELIGQSIVVQSLMNAVKR
SRIAPVYLFQGPRGTGKTSTARIFSAALNCV-ATEE--------MKPCGYCKECNDFMSG
KSKDFWELDGANKKGADKVRY-LLKNLPTILPRNSSMYKVFVIDECHLLPSKTWLSFLKF
LENPL-QKVVFIFITTDLENVPRTIQSRCQKFLFDKLKDSDIVVRLKKIASDENLDVDLH
ALDLIAMNADGSLRDAETMLEQ-LSLLGK-RITTALVNEL--------------VGVVSD
EKLLELLELALSSDTAETVKRARELLDLGADPIVLMSQLASLIMDIIAGTYKVVD-----
---EKYSNAFFDGRN-------LTEADMEGLKHALKLLSEAEKQLRVSNDRSTWFTATLL
QLGSMPSPGTTHTGS----------SRRQSSRATDDDPASVSRE--------------VM
AYKQR-------IGGLHFSKSASPAS---VIKRNGNHSHEAKPFSRVIDNNCYKSSSSSQ
MIESEGSI--ASHENSIAST---------------------------------MMLNQRS
SEKLNDIWRKCIERCHSKTLRQLLYTHGKLISI--------SEVEGILVAYIAFGEN---
DIKLRAERF---------------------------LSS---------------------
-ITNSIEMV--LRRSVEVRIILL--PE--------------------------TE-LL-V
VPHQTRKPEMTNK-SGHLN----------------NIAGLNA-ETDVEVGSSVESRSKLP
MQRIES----------------IIREQRLETAWLQTADKD---TPGSIIRVKPE---RNQ
ILPQ-------------EDT-YRQ-------------TNVASAISSSGLTTHQW-VDELN
NEVKLLKIGDNGELQENLTGTRGQHCPLSPSL-----LHDTNF-GNNKDNLGGYESGSGR
VGCNILF-CWNTKK-----------------------TQRRSKSKQVKGTP--------V
RS--RRNRKSRF--------SLF----NGCAK---------------------------P
RKAEG----------NI----RR
>gi|115351816|ref|YP_773655.1|	   824 residues, 50 /line  DNA polymerase III, subunits gamma and tau [Burkholderia cepacia AMMD]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------MTYQVLARKWRPKDFASLVGQEHVVRALTHALDG
GRLHHAYLFTGTRGVGKTTLSRIFAKALNCET-GVT--------SQPCGVCRACREIDEG
RFVDYVEMDAASNRGVDEMAA-LLERAVYAPV--DARFKVYMIDEVHMLTNHAFNAMLKT
LEEPP-PHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEEQISFELQ
ALRLLARAAQGSMRDALSLTDQAIAYSAN-EVTEAAVSGM--------------LGALDQ
TYMVRLLDALAAGNGPEILTIADEMSLRSLSFSTALQDLASLLHRIAWAQFAPGS--VLD
E----WPEAADLRRF-------ADALSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLL
RMLAFEPAVGAGSAPGG---------QPAVPRAVP------------APAPRATAAAVSA
--AAPKSAAVPVA-APAPKAPAVAAP---AAAAEAVRPQAAA-----------PVAPAAR
PSPVQSGD--AVTSSAVKPVATPAAASAE---APAAPQPQANPAPQV-------------
APASDAPPAVRNEPE---PSAAAKRVDEPAAPA--------VA------KRVDEPAAPAV
AKRIDEPAA---------------------------PAEPAPRATPAAPAAPAARPSARG
GAAAALDVL--RNAGMRVSSDRS---RADAA-------------PKSAAAQPAAD-KPAP
SRPAVQVPTP----RAA--------------------------------------ARA--
--------PQAADTRQAP--PPWEDIPPDEYVPLSADEMFGGGADDGFVPVFDSGPDDVR
IAPKPAEARPSAP----VDTRPLPPAIALDPIGFDGEWPALAARLPLKGVAYQLAFNSEL
TAVDATTLKLSVPVPQY-ADAA-QVAKLKAAL-----ADALGK-PVEVA-------VEVG
PARRTAAALDAAA----------------RAARQREAEQEIH--------------GDPF
VQQLVR--DFGA--------RIVEGS----VR----------------------------
----PLADSAPDG----APPTLH
>gi|118029019|ref|ZP_01500480.1|	   793 residues, 50 /line  DNA polymerase III, subunits gamma and tau [Burkholderia phymatum STM815]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------MTYQVLARKWRPKDFASLVGQEHVVRALTHALDG
GRLHHAYLFTGTRGVGKTTLSRIFAKALNCET-GVT--------STPCGVCRACREIDEG
RFVDYVEMDAASNRGVDEMAA-LLERAVYAPV--DARFKVYMIDEVHMLTNHAFNAMLKT
LEEPP-PHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEENIAHEAQ
ALRLLARAADGSMRDALSLTDQAIAYSAN-QVTEEAVRGM--------------LGALDQ
SYLIRLLDALVAGGGAAVLSVADEMALRSLSFSTALQDLASLLHKIAWAQFAPSS--VLE
E----WPEAADLRRF-------ADALSPEQVQLFYQIATIGRSELGLAPDEYAGFTMTLL
RMLAFEPASNGGGGSGG---------G-------V------------APAGR---TSVPA
--AGAKRTGAPVA-A-APQARATGAA---A------------------------------
----------------------PSAASGE---PGVAPIVKAEPAPVQ-------------
PPVVQQVPATAASTDLVAPEIEAAPVDGDATPL--------SASAAQAAASVETPVA---
SNGTEQNAA---------------------------PHD-------GMPALAAAAPRRAG
GASAALDVL--RNAGMKVSTDRG---RSAVS-------------TSAAAAAPATPVKAAA
PRVAVRVPTPDPARRAA--------------------------------------AAAQQ
ESAARAPTPRAAEPQGASAVPPWEDIPPDDYMPASSDDAFFAPPDDNFVPVFDSGPDDML
VGRGHASAAASAPAAPVIDIRTLPPAVPLHAIGFDGDWPALAVTLPLKGISYQLAFNSEL
MAVNGKTLKLNVAVQLY-AEPA-QIAKLKAAL-----AERLGS-EIDVQ-------VEVG
PVQRTAAVLDSIE----------------RAKRQQEAEREIG--------------ADPF
VQSLIR--EFGA--------SIVPGS----VR----------------------------
----PLMPGAEGG----QSAA-H
>gi|115474561|ref|NP_001060877.1|	   799 residues, 50 /line  Os08g0120200 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
-------------------------------------------MIEGRRHSVDIPISRAL
LAVMR--SRSLRDPETNSLAKFSAKKT-----------------------------IW--
----EGCSLEEDDLEGSNYGRHSFS-----------------------------------
----------------------------------------------------------YN
MYDHLQRRR----E----------------------------------------------
-------------------------------------EFGDSAR------SGRLVNSPIN
IIK---------------------------------------------------------
-------------------------------A---NARVKAALHNQTCSSVISGMSR--A
------------------------------------------------------------
-----------------------------------------------------TKDRASS
LMIEGEQLGR---------REGATFQESARSLLQKYRPKAFSELAGQNVVAQSLSSAVLK
GKLAPIYLFHGPHGIGKTSAARIFAASLNCHS-SGG--------NQPCGHCEECMAIFSG
NSSSVIEIDASKLDCKSRVAA-LLRNACEVPA--SSHFKVLIVDDCQHMDKEGWYSVYSS
LEGIP-DSSIFVMITSDIDKLPSNSVGWCQSYRFCKVDEAEIALRLSRICINEGMEFEAE
ALELIARKANGSIRDAVQMLDQ-LTLLGK-RISKSVTYDL--------------IGDVSD
EELLDLLNLAFSSDAATIVRRARELLSSKVDPLQLLAQLANLIMDILAGRHQSDS-----
Q----EVRKVTGKHT-------SAEIDVHKLRNALEILSETEKQLKTTKNQSTWLTAALL
QFNMREPYCLDDAAVSS---------MFTE------------------------------
------------------------------------------------------------
-SQTDDGA--AILKDESLDTSSHLCYQNK---IGCLDMNLGD------------------
PDVLETIWIKALENCTSKPLHSLLRKDGKLSSL--------YTTQGVAVAELQFCHP---
EDVPTTESF---------------------------WNP---------------------
-FVVSLQNL--LKCNVDIRINLS---PISTS-------------NRVVSKNSSVS-LVMQ
SREDQETEDPVAAG-----------------------------------------CRTVA
SSRKECPSPLAVQPK---------------------------------------------
-------------------------EKPSHILGCLHATDGDAVDTESRILSYQ-----KI
SVIPEASTPGNGSFKAG-GHTP-KVDEARA------------------------------
------------R----------------RGCFSKLLQRRAG--------------APYQ
NGALPR--RGLF--------KCCFCKIRPDCK----------------------------
----TKVEETDGF----QGHSKN
>gi|118737307|ref|ZP_01585711.1|	   716 residues, 50 /line  DNA polymerase III, subunits gamma and tau [Dinoroseobacter shibae DFL 12]
-------MRRALQPGAAKGNA---------------------------------------
---------------VFEWHGPCP--------------------------PSRPCLPRD-
------------------------------------------------------------
------------------------------------------------------------
-----------------------------ARR--------------------RNRRPALR
TGRVLQ---------------SRGRMRISQIER-----------------LARASASPT-
--------RSDPEGS-------SRNEP---------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------RLGRC-PASHLSPTRRL-LRPEWYAAAP--RRWTLPL-------------
-----RGPTLWPERV-----------------------------------------RWG-
-------------------DMSDTTTTGYQVLARKYRPATFADLIGQDAMVRTLRNAFQA
DRIAQAFMMTGIRGTGKTTTARIIAKGMNCTG-ADGA---GGPTTDPCGQCDNCRGIMAG
QHVDVIEMDGASQTKIDDIRANVLDSVYYAPA--SARYKIFIIDEVHMLSTSAFNALLKT
LEEPP-AHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIAHLRRIAGLERAEITDD
ALALITRAAEGSVRDAMSLLDQAISHGAG-ETTAEQVRAM--------------LGLADR
GRVMDLFDLVMRGDAAGALTELSAQYSDGADPMAVLRDLAEVTHWVSVIKITPDAAED--
-PTVSPDERARGQAA-------AAELPMRALTRMWQMLLKALEEVAISPNAMMAAEMAII
RLTHVADLPSPEDLVRKL----------------QTMTPPPATPGG-GAAPGGPGTGVSA
RGHGAAPAP-----------------------RGGGVRAS--------------------
--------------------AGPALAMAQ-------------------------------
------------------------------------------------------ADP---
DALARFRRF---------------------------DDV---------------------
-VAL-------IRSHRDVKLLVE--VEGCLRLA-------------------AYS-PGRI
EFAPTENAPRDLAARLA--------------------------------------A----
-------------------RL---------------------------------------
---------QSWTGAR---------WAVSVVAEADA------------------------
--------------------------------------------PTIAE--------TRD
A------------EKLEMERNALDH-----------------------------------
------------------------PLVAAVFAA---------FPKARI---TEIRTREAL
TQEAAIEALPEVEDEWDPFE-DD
>gi|125579060|gb|EAZ20206.1|	   949 residues, 50 /line  hypothetical protein OsJ_034415 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
-------------------------------------------MADMRRHSVDVPLSRTL
VQLKR--VRSLRDPATNSLSKYASPS----------------------------------
-----------------------DNMIWETASSNGV--AMDLGRSAHHQLI---------
------------------EEDGDLEAEATLGS--------------------ERSFRAPN
ARTASYRKS----S----------------------------------------------
--V--VKIRGLNPPR-------NKQAHRARQDGHRK-----SVDSSHSNHSSIRQLANTM
---VNNVAEEKEEEEEVN---------SYERSVPTPPAKTDEEVKMPGFSKFRNKSSA--
----AMSRVGSPCMSASEA-RSVRSRRTEETQ---VRSNDVVGSNFSGCGISYCWSG--A
SKYRE-LYYD--------------------------------------------------
-------SDGPEQPLLSPEG----------------------------------------
------T-DAAF-------QENVPYTETPRCLSQKFRPRSFSELIGLNVVAQSLLYSSCK
GKVAPMYLFHGPRGTGKTSTARIFAAALNCLS-LEE--------QRPCGFCKECVILFSG
RSRDVKELDAAKMDRLGRVKA-LLKSASLVPY--SSRFKVFIVDECHLLPEDAWSAILKS
LDEPY-RHAVYIMITSDIDSLPRTSITHCQKFHFPKIKVADIVYRLERICIEEGLEFDHD
GLYFISAKSNGSLRDAEIMLDQ-LSLLGK-KITISLVHEL--------------VGSVSD
DELIELLDLALSSDTTNTVRRARELMASAIDPLQLVSQLANLIMDILSGRCQSAV-----
---TEVSKSFLGRYA-------LAEVGIKKLRHALKILSETEKQLRTSRNQATWVTVALL
QFGTNESNLIAESNDMHAHSAIGYTD----DWVSKVNSSSNFC-----------------
-----------------------------------------------------------H
ACNSNKSN--CSERH-------------------------------------------CR
RLKLENIWRRAIGKCQSRSAKNFLRKEGFLSSV--------HVTEELAIAEVGFSHP---
DHISRAEKM---------------------------QSL---------------------
-IESTLQNV--LGCNVEVKFKLV--PRPVR--------------KDARSKRQSFS-LLSC
SGRKQ-------------------------------------------------------
--------------------------ELSDSAVTDEDETVRHGARE--------------
--TPSKGYSSQ----Q---------QSPFIMQRTDSKPTVHGCEDDAR------------
--------------STL-TSNRSMTDDMTRTCRSETNYSKGVS-----------------
---------------EQGRFDSIQEPDLQPNCFSRTLKLQKRFFSSDAAHTICLKIQPHN
KMDFLPKK--EFDTYFCAYEPYEQCSRSNSHATCSSRDD---------------------
---------------------NL
>gi|125588189|gb|EAZ28853.1|	   1022 residues, 50 /line  hypothetical protein OsJ_012336 [Oryza sativa (japonica cultivar-group)]
MPT----PDR----------AGAV------GATARGG-GGGGG-HLRGHAHLTNCIHLRH
HHAHGGGGGGGGASSSGRRRSPT--------------------------SVASAALMRDL
LALQR--SRSLRDPSTRRSVESSSKVA-----------------------------AD--
----PDADTDEDDADLPPKSRRSASTT---------------------------------
------------------------------------------------------------
--------------------------------------------------GALKTLLDQL
AE---------------------NPQPKQVRRPPRRFKRGAGRR------AGAASKAPDR
SAAAAAAAAALSVNSSSQEAVCGNKYLFR--DGE----DG--------------------
----------------------------LD-E---LQQHVPPQDSRNVCGIPWNWSR--L
-HHRGKSILDMAGRS-LACGLSDPKSA-AGRKSEAGAG--ASRGHLNGS--HSLFPVKSE
RLASSTSSDSDALPLLVEAAATGARN--------GGIGGSYSGELGIFSNQT--SEMESD
LLSEGRS-GHKSRGSQHG-------RGRHRSLTQKFAPKTFKDVVGQSLVVQALSNAVLR
RKIGLVYVFYGPHGTGKTSCARVFAKALNCHS-PEH--------PRPCDSCTSCIAHNLG
KSRSVMEIGPVGNIDMDGIVD-VLDNVMLSPA--PSHYRVFIFDDCDTLPADTWSLISKV
VDRAP-RRVVFILVSPNLD-LPHIILSRCQKFFFPKLKECDIVNTLQWISTSESLDVDRD
ALKLIASRSDGSLRDAEMTLDQ-LSLLGQ-RISLSLVQEL--------------VGLVSD
DKLVDLLDLALSADTVNTVKTLRDITETGVDPLALMSQLATIITDILAGSYTFTR-----
---ERLRRKFFKRPT-------LSKDDMEKLRQALKTLSEAEKQLRVSNDKTTWLTAALL
QLAPDKQYVLPSSSST----------SLNHGVLAGSFPDRDMAIHS--------------
---------ALEHNGNMASTSYRERRPVE-------------------------HTSNSH
LLSTSAPR--ANEQSR------------------------------------------NS
KIENELIWHAVLESIQSDTLRKIMAKEGRLSSV--------SLGTAPTV-QLIFSSR---
VNKSKAENY---------------------------RGQ---------------------
-ILQAFESV--LRSAIILEIRYE--SKNDVRASHAPAVFSHGE-NESSNTTLRRS-FTKH
SPLSS--GGENLRRRLK--------------------------------------K----
-------------------DR----ASSSKTTWMQSDPHILTEG--EIIEVGPS---HMH
WHDETN--------ND---------VHNVNQRRKDNVWEEESLASPNSKANQGRN-----
-------------GNKQ-RRQN-SIVKGKVSL-----AHVIGK-AEACS-----------
----QRGG-WS-------------------------------------------------
------------------------------------------------------------
RQKAL---SIAEKLEQE----NL
>gi|125594969|gb|EAZ35028.1|	   1011 residues, 50 /line  hypothetical protein OsJ_018511 [Oryza sativa (japonica cultivar-group)]
MPA----PAA----------TAAA------GMGSGGGGGGSGEHHMRGHAHLTNCIHLRH
HHAH---GLGAGSASSGRRRSPTG-----------------------SSASASAALMRDL
LALQR--SRSLRDPSTRRSGVGLGL-----------------------------------
------GDYFQDESSRP---------G---------------------------------
------------------------------------------------------------
--------------------------------------------------CALKTLLDQL
AE---------------------NPQPKPSRGPRRRFKGGAGRR------AAPASATGGA
LDRGVDGAAAVSVNSSSQEAVCGNKYLFGVVGGDDDDDDE--------------------
----------------------------CGVE---LQRPQASQDSRNVCGIPWNWSR--I
-HHRGKSFLDMAGRS-FSCGLSDPKSASAARRSIAATSA-GSCGHMDGSRSHPHFPVTAR
--LTSTSSDSDSLPLLVDGVRNGI----------GGIARSFSGELGIFSNQT--SELDSD
LASEARS-GQRSRGSH---------RGRHQSLTQKYSPKTFKDMIGQSLVVQALSNAILK
RKIGLVYVFYGPHGTGKTSCARVFAKALNCHS-PEH--------PRPCDSCASCIAHNLG
KSRSLVEIGPVGNIDLDSIVD-ILDNVMLSPV--PTQHRVFIVDDCNTLPPDTWSVISKV
IERAP-RRVVFILISPNLD-LPHIIVSRCQKFFFPKLKECDIVNTLQWISTSEGLDVDRD
ALKLIASRSDGSLRDAEMTLDQ-LSLLGQ-RISMSLVQEL--------------VGLVSD
DKLVDLLDLALSADTVNTVKTLRDITETGVEPLALMSQLATIITDILAGTYAFTQ-----
---ERVRRKFFKCPT-------LSKDDMEKLRQALKTLSEAEKQLRVSNDKMTWLTAALL
QLAPDKQYVLPSSSTS--A-------SFNQGLLT--CPEGDIGRST--------------
---------AIDHTNIYA------------------------------------------
-----GPH--GLPRNA------------------------------------------NL
GVDSD----------------NNMAGTRR------------GKGPAPTV-QLMFSSR---
VNKSKAERS---------------------------REQ---------------------
-VLHAFESV--LASAITLEIRYE--PKDDARAGHVPAISPYPE-DSTSNVALRRS-FTRH
SSASS--RGENLIRRLQ--------------------------------------K----
-------------------DNVVHGANSNQTRWVQSDPHILTEG--EIIEVGPS---QVD
WHSEPN--------NS---------A----GVRKENI------------VLQGREVV---
-------------NNEH-GRQN-SIVRGKVSL-----AHVINK-AETCS-----------
----QQGGDWSLSRV----------------YFVGRLQALLDERVHSIGYLDLPLFES--
------------MQLLAF---------------------------SLK---ETPYIKAAA
LQPAY---ALSQVYPRE----KR
>gi|4539401|emb|CAB37467.1|	   1057 residues, 50 /line  putative protein [Arabidopsis thaliana]
MTTTTTTTTR----------VASSSSTRNNRILKDAN-GDIGE-HLRNHIHLTNCIHLKN
NM-H--------------KQSPVL-----------------------T----DRALMRDL
IVLQR--SRSLRDPSASPPAWNTPPSV-----------------------------VDLL
PKKGDLVEGGRRSVDLKKSSRRLSALSGSSPVVNFG--TSKVTPSDERSGP---------
------------------VSGERDSGRRVKRE--------------------ESSRKSYR
IGDDYQNVN----EVVSHGSGSKASRRLSRVND-----------------AMVKTLSDQL
NEV--VVGDS-------------DDVVSSNVRPRVRYGGGGGGG------NTRGCAGGMS
RPKRRKFRGTRRVRGKSRDTGGGKSEM--SVASNTLPQVE--------------------
----------------------------KHDG---EKEGFGEQNMTKACGIPFNWSR--I
-HHRGKTFLDKAGRS-LSCGMSDSKG---GRKGETN--------ERNGS--DKMMIQSDD
DSSSFIGSDGEALPLLVDSGEN------------DGWVHDYSGELGIFADSLLKNDEDSD
LASEGRS-GEKKHKKKSHVNARHRHRQQHQSLTEKYTPKTFRDLLGQNLVVQALSNAVAR
RKLGLLYVFHGPNGTGKTSCARIFARALNCHS-MEQ--------PKPCGTCSSCVSHDMG
KSWNIREVGPVGNYDFEKIMD-LLDGNVMVS---SQSPRVFIFDDCDTLSSDCWNALSKV
VDRAAPRHVVFILVCSSLDVLPHVIISRCQKFFFPKLKDADIVYSLQWIASKEEIEIDKD
ALKLIASRSDGSLRDAEMTLEQ-LSLLGQ-RISVPLVQELVSIVLSHHHIKQLKVGLVSD
EKLVDLLDLALSADTVNTVKNLRTIMETSVEPLALMSQLATVITDILAGSYDFTK-----
---DQHKRKFFRRQP-------LPKEDMEKLRQALKTLSEAEKQLRVSNDKLTWLTAALL
QLAPDQNYLLQRSSTA--DTGGRE--SSDHHLD--PSSDAAGGRSS--------------
---------GLDRRR---------------------------------------------
------------GDSR------------------------------------------KN
RPAVEEIWLEVIEKLRVNGLREFLYKEGRIVSL--------NLGSAPTV-HLMFSSP---
LTKSTAEKF---------------------------RSH---------------------
-IMQAFEAV--LESPVTIEIRCE--TKKDPRNN-VHHHHHHPT-VKDK------------
------------------------------------------------------------
-------------------------SLPQSLALIGHDYNIDGSGRSEIVEVTES---NGQ
RRQQQK--------QQ-------------EEERTEPVG---SSALARARRKHL-EAS---
--------------QSQ-NQSQ-SIVRGKVSL-----AHVIQQ-ADGCS-----------
----LQNG-WS-------------------------------------------------
------------------------------------------------------------
KRKAV---SIAEKLEQE----NL
>gi|9758675|dbj|BAB09214.1|	   900 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
-------MSR----------VASS------RVLKDSN-GDIGE-HLRNHIHLTNCIHLKN
HM-H-----------NNNKQSPVL-----------------------TDR---SLLMRDL
VVLQR--SRSLRDPSASP---------------------------------------NLK
EDHQDSREGRRRSG---------LRLSGSSPIVSFG--TSKVTPSDE-------------
-----------------------------KFD--------------------RSSRKSYR
V-EEVNEVY----SVPSVKSVSK-DRINKKVNE-----------------AIVKTLSDQL
NEV--G-GDSDDLVS-------CNVRPRGDGCRRRKFR--GTRR------AGRAVNVRDN
---AAGNESEMSIASNSVPR--GEKYEGE-------------------------------
-----------------------------------EGGGGRDREQNMSCGIPFNWSR--I
-HHRGKTFLDIAGRS-LSCGISDSK----GRKGEAGT----------------------P
MFSDSSSSDREALPLLVDSADN------------EEWVHDYSGELGIFADNLLKNGKDSV
I-------GKK---------SSRKNTRWHQSFTQKYAPRTFRDLLGQNLVVQALSNAIAK
RRVGLLYVFHGPNGTGKTSCARVFARALNCHS-TEQ--------SKPCGVCSSCVSYDDG
KNRYIREMGPVKSFDFE---N-LLDKTNIRQQ--QKQQLVLIFDDCDTMSTDCWNTLSKI
VDRAP-RRVVFVLVCSSLDVLPHIIVSRCQKFFFPKLKDVDIIDSLQLIASKEEIDIDKD
ALKLVASRSDGSLRDAEMTLEQ-LSLLGT-RISVPLVQEM--------------VGLISD
EKLVDLLDLALSADTVNTVKNLRIIMETGLEPLALMSQLATVITDILAGSYDFTK-----
---DQCKRKFFRRQP-------LSKEDMEKLKQALKTLSESEKQLRVSNDKLTWLTAALL
QLAPDKQYLLPHSSSA--DA------SFNHTPLTDSDPSNHVVAGT--------------
---------RRDDSKQ--------------------------------------------
------------GFSC------------------------------------------KN
RPSVEDIWLAVIENVRVNGLREFLYKEGKIFSI--------SIGSA--------------
--KSTAENF---------------------------EEH---------------------
-ILKAFEAV--LGSPVTLEMRTE--SKKDLGFSSLQGL----------------------
------------------------------------------------------------
----------------------------------SNGERFRESGRSEIVEVADS---E--
------------------------------------------SPMTRVRRKHL-EAS---
-------------QNQN-QNQNQSIVRGKVSL-----AQVIKQ-AEGNS-----------
---------WS-------------------------------------------------
------------------------------------------------------------
KHKAV---EIANKLEQE----NL
>gi|139438753|ref|ZP_01772237.1|	   825 residues, 50 /line  Hypothetical protein COLAER_01240 [Collinsella aerofaciens ATCC 25986]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------MESLYRKYRPLTFDSVVGQQHIVSTLEHAITE
GRLSHAYLFCGPRGTGKTTMARILAKALLCRN-AEAARAEGASGCLPDGACEECELIAEG
NHPDVYELDAASRTGVDNVREEIINSVNFAPV--RGKYKIYIIDEVHMLTTAAFNALLKT
LEEPP-AHVIFVLCTTDPQKILETILSRCQRFDFHRIGNEDIEHRLSYVCEQEGFDYDDE
ALAIVARHAKGGMRDALSTLEQ-LSVFGNGSVHADDARSL--------------LGEVSD
QILGEFSRAIADRDVAELYGLIRAQVEEGNDLLELTRDLVAHVRDVYVACVAGARAELFE
GGSEQAEALAAEAAA-------FGEHPADRLARVLTVLDDAALEMRGASDVRLVLEIACT
RLARPEADLTIEALAE--RVARLEA-------MIANGAVPASVA---AAQAAAPAASVPA
--AAQQPTLISGARAAAPAASAAPAA---TSARQGGMPWDRG-----------AAVPAAQ
PAPKSAAP--APAPRPVTPAPQPVAAPASAPAASTVSVSKPNNAAQVAAAGAAETPAVED
AGELQRKWAEVVERVKARQASYAGLLLNARATADDGSKLTVSFPAGSTFAIKMLGRA---
DTQSVVLP-TVCAV--FGRRTVDYVLDGGGTPAPQH------------------------
-----------EEHSPSARAAV--SADPQPVSSVPPASSS---------ASATQP-KAAP
VAAPTPSAPEPAAPKPA-------------------------------------------
----------------------------------------------------AP---IPA
PKSAAAPA----------------------------PKSSDLAKAPWL------------
--------------RSD-NPAG-APATGKLPT-----EPAPRA-PERAS--------VPM
AQPPAQAAPWESEQV-PYDDAMVGGFAAD-AGGDDLPPFDVSGAASATKAAAVAPAAS--
------------ANDDVPAAPWESNPGA---------GSPFGH-----QGAAPSIPQTED
EAKALIRSVFGQATIFKPV---E
>gi|147765605|emb|CAN69246.1|	   1057 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----MRSLRNHHYHAWPKRQNQADRKSESKEKNDNN----VNRTKRRRFIKGQKAVPSE
EARW---ATFSRHSNKTRRRSTTLFWISIVDEVLIFVFHFMVLMMDGRRHSVDIPISKTL
VALRR--VRSLRDPSTNSMSKFSALV----------------------------------
-----------------------DSLNWETNSSNGI--SLRFVNGFQEGGP---------
------------------DN-NGXLGLENFPG--------------------Q--REELY
GGL--RKPD----PKLFSSEN---------------------------------------
PGF--FGNTGLAPTV-------TKRADGLDYCGTIKEEAYDKKSLSERYCSGLRENGLDL
---MNITPSSNGLEGADS---------CNGPILGSSHAERTDHXASKWKSQYKNQLKSFT
GLGDVVSCVGSPCPSLSDVLLEGSSRSTSLLA---NEESNAIDHNDRGCGIRCCWSR--T
PRFRESN-----------------------------------------------------
-----LLSDVEDNPLLLGEV----------------------------GETILSGQKWSW
---------------KCFNNEITPYSESPRSLSQKFRPKAFNELVGQNVVARS-------
------------------------------------------------------------
--RDSKEIDTVRINQTGRMRS-LIKHAIGRPV--SSRFKVFIIDECHLLRGETWATVLNS
LDDLP-QHVVFIMITPSLDKLPRSAVSRSQRYHFPKIKDADIASKLGRICVEECLEFDQV
ALDFIAAKSNGSLRDAEMMLDQ-LSLLGK-RITMSMTYEL--------------IGIVSD
DELLDLLDLALSSDTSNTVRRARELMRSRIDPMQLISQLANLIMDILAGKCQEGT-----
---SEVRXNF-FEGH-------TSEVDLQKLSHALKILSETEKQLRASKNQTTWLTVALL
QLSSVESSFLDANDSR--AFLRTEHPRGENVKRLVTCACDNNKPHI--------------
------------------------------------------------------------
-----------------------------------------------CEVQED------C
KGQLEFLWKQATEICQSSSLKNFLRKQGKLSSV--------IVSQGMAVAELEFQHP---
DYVSKAEKS---------------------------WKL---------------------
-IASSLQSI--LGCNVEIRINLA--PCTSVK-------------GYAKVKKPSFS-FFSC
SRRMR--LKSHSTSEHG-------------------------------------------
------------------------------------------SDQSDCSDFTSE---KAM
IRDKTIGTCSSDCGSQ---------VSHVCYXRTEAARTLRNREGNVL------------
--------------GIG-TITP-HRS-------------------------------FQB
EIPKGTGFEV-GSSKEEQSSCGCQEPENQPNCLFNTFGLHKKLRSSEASQMTCLRYQAQN
KLALSVPKNTSFEPYFWANDRYAFSSSSNNFNSCPRDEDGLREDSKVHCWGAPTFPLKKA
WQSRHRREGSNLVGWVLPCGATK
>gi|15233988|ref|NP_194210.1|	   815 residues, 50 /line  ATP binding / DNA-directed DNA polymerase [Arabidopsis thaliana]
------------------------------------------------------------
-------------------------------------------MGETRRHSVDVPITRTL
VALRR--VRSLRDPCTTSMSKFASLL----------------------------------
-----------------------DNVKWETGSNNGI--SLQFVEHADDACK---------
------------------AAADAPVGLIPFGS--------------------YSIMEELE
SGCDLHKLS----SKVINVEG---------------------------------------
-----------------------------DAC----------SRSSERSCSDLSVKGRDL
---ACNAPSISHVEEAGS--------------------------GGRYRTHYSTKLAS--
SVGEYGSRLGSPM----------NSTNHSYYG---DEDVDFDSQSNRGCGITYCWSR--T
PRYRGSN-----------------------------------------------------
-----QSSDVEEYPLLPGNG----------------------------NGESD-------
-------------------VVTPSHEVLSRSLSQKFRPKSFDELVGQEVVVKCLLSTILR
GRITSVYLFHGPRGTGKTSTSKIFAAALNCLSQAAH--------SRPCGLCSECKSYFSG
RGRDVMETDSGKLNRPSYLRS-LIKSASLPPV--SSRFKVFIIDECQLLCQETWGTLLNS
LDNFS-QHSVFILVTSELEKLPRNVLSRSQKYHFSKVCDADISTKLAKICIEEGIDFDQG
AVDFIASKSDGSLRDAEIMLDQ-LSLLGK-RITTSLAYKL--------------IGVVSD
DELLDLLDLAMSSDTSNTVIRARELMRSKIDPMQLISQLANVIMDIIAGNSQESS-----
---SATRLRF-LTRH-------TSEEEMQKLRNALKILSDAEKHLRASKNQTTWLTVALL
QLSNTDSSSFATDEN----------GRNQINKDVELSSTSSGCPGD--------------
------------------------------------------------------------
VIKSDAEK--GQERNC--------------------------------------------
NETVESVWKTVTDLCCSDSLKRFLWKRGRLTSL--------TVDKGVAIAELEFYTP---
QHVARAEKS---------------------------WKL---------------------
-IADSFQSV--LGCNVEIQMNLVISACSPPK-------------SAKAAASLFFG-LFSC
SRRML--HKSYLTTRTD-------------------------------------------
------------------------------------------------------------
----------SDCASE----------------KPAVTNSLRSCQGNVL------------
--------------RAR-SV------------RSSAN-----------------------
------------------------------------------------------------
-----------------------------------------------A---SSRMSCSSD
QGDATSAMCTPHIPPGE----KR
>gi|23129966|ref|ZP_00111787.1|	   707 residues, 50 /line  COG2812: DNA polymerase III, gamma/tau subunits [Nostoc punctiforme PCC 73102]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------MSYEPLHHKYRPKSFAELVGQEAIATTLTNAIGT
SKIAPAYLFTGPRGTGKTSSARILAKSLNCLK-SDRP------TAEPCGVCDVCQGITKG
YALDVIEIDAASNTGVDNIRE-LIEKAQFAPV--QCRYKVYVIDECHMLSTQAFNALLKT
LEEPP-RHVVFVLATTDPQRVLPTIISRCQRFDFRRIQLEAMVKHLSAIASKENIHISPE
AVTLVAQLSQGGLRDAESLLDQ-LGLLAG-VVTPDRVWDL--------------VGTVSE
QDLLGLLNAIAQDKPEAVLDSTHKILDRGREPLTFLQNLAAFYRDLLIAKTAPNRHDL--
-VACTQQTWTALVEF-------AQYFDMTMILAGQEHLRKAEVQIKNSTQPRLWLEVTLL
GLLP--SATTNIQPQ----------APNIAPRVIPPAVSPS-------------------
-----YPPAVTQNHAVSSLPVAEPQTNHNSTLRQGSVTTNHH-----------VAIAQNQ
PVTSSGAV--EQQKNHNSAAN---SVSPPTPEPVAVPVPSAIVEAVTSEVVGE------A
QYDLTQVWQQVLANLQPKSRQEMLRQMSQLI-----------EFDGVM-ARIAIK-Q---
AWYDKGKSY---------------------------LPM---------------------
-ITAAFQQT--FQREIQINIEKGISSNSTSAKKNPPPKDSSRVQQP------ATP-SYNQ
QIS-----PPALVPQPA-------------------------------------------
------------------------------------------------------------
----------TPAPLR----------------TEPLAKNGNGANGNGA------------
--------------NGN-GVNG-NGVNGNGANRN-----GANR-NGAQT--------LPP
PPQRTPAPDWEIDEVAIAAQRLAEFFNGQIIR----FTEDSTEFSDSIATPEWVEESE--
------------VDD---------------------------------------------
----------------------E
>gi|86608779|ref|YP_477541.1|	   779 residues, 50 /line  DNA polymerase III, subunits gamma and tau [Synechococcus sp. JA-2-3B'a(2-13)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------MATAGNYEPLHLKYRPQRFADVVGQGAVVQTLANAIRL
GRVAPAYLFCGPRGTGKTSSARILAKSLNCEQ-GPT--------PDPCQACSQCRAITAG
ASLDVLEIDAASNTGVDNIRE-LIERAQFAPV--NSRYKVYVIDECHMLSNAAFNALLKT
LEEPP-PRVVFVLATTDPQRVLPTIVSRCQRFDFRRIPLDDMVAHLGKIAAQEGIPITPE
ALQLVAQLSQGGLRDAERLLDQ-LSLLEG-SITPEAVWDL--------------VGGIPE
QQLLALMDALLAQDVQAVLSQTRQLLERGKEPLALLQNLVALYRDLLLVKTAPQQREL--
-VAVTDSTWAALQQR-------APRYSVEILLAAQSHLRQCEPQIRQSGQPQLWLEIALV
DLLGQLRPSMVAEDS----------AERSPFPALDLSPAPQRTPPD-GTAPPAPAATISP
--S--SPSTVGEIDELTVGPSASPAV---ASSQKADRATRTE-----------SSEQPRE
PARDAATV--K-------------------------------------------------
--LLRPHWDEFLKRLSPLTKALMGSGH-LHQ----------ETPEAITLAFPSKGLV---
EKVRSKEAELRSVLHNLLQRPVQLNLIVQRSSGPHVSIR---------------------
-VSGAESSALLSRETDLPPAPVAPDPVTTPGLQSDSTNSRASSREPRAEPQSHGL-ARRQ
QHSPSDSNPPSPEPERD-------------------------------------------
------------------------------------------------------------
----------NP---------------------MGGPKVA--------------------
------------------GLAT-QGLSPAGANKVLRTAVATDS-PSRAE--------RRD
TLHGGQSFELT-QELAEIARCFADHFNGSLVDLEGVLESDVTGSTEELSSIEAIEAEG--
------------SPDLLSGETYGSPTGAEPSASAGRSPHPVDFPNAVR---NPSYRREQS
SQLAVRLSGTESLEEEV----PF
>gi|115487814|ref|NP_001066394.1|	   1174 residues, 50 /line  Os12g0209300 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------MGP----------------------------MVEGCVGPSELHLRKEL
TALRK--ARFLRDPETSSTWRSPLDSRPLA------AASNIVH-----NSNGVGDSIAPK
H-TESPTPSKGE-----KKQKKVYLYNWRQYSNK--SSESGM----------KLDED---
----INLESPHNSNGVGLKSNA--------------------------CQDDPVNIYNFQ
SSTSCTPIKRVARR-SRVLLSKKGTAR--DPAVSKLL----------DLHV---NSTEQT
EDTEN----------SEVGYFSRPTSPLFAACGCVS-ASNTSRL------LK-VGRREG-
SSFS--CTP-IS--------------------------------------------TR--
SYYKHGRANSSTIGSWD------GRTATSFDGDES---NQSTLWRSRRSHVPGYSSKRN-
-KCKG------SKRS-YSPSL-----SDILRRKGSGLLCGSQTLHRKK-RS--FGS-LKW
--GHSKTSAHG-MSLLDGSCD--FGSSSFDS--SSDELSTNVGELDLEALSRLDGRRWSS
--CKSQD-GVDP-AVHGA----DLAMADRRSLSQKYRPKLFSEIVGQHIVAQSLSNAITR
EKIAPAYLFQGPRGTGKTSTARIFSMGLSCL-APGE--------NKPCGICKECTDFLSG
NGTNLIEVDASNRKSINRIKN-LLENIPPSAT--SSRYKLFVVDECHMVSSKLWSAFMKF
LDEPL-PRVVFVFITIDPDNLPRAVISRCQKYVFSKIKDIDIVCRLRRICVKENLDVELA
ALDLIALNSDGSLRDAETMLDQ-LSLLGK-KITPSLVNDL--------------VGVVSE
EKLLDLLEIAMSSDTAETVKRSRELMDSGIDPMALMSQLAGLIMDIIAGTYKLAD-----
---STANDMAVGGRS-------LTDGELERLQQALKILSDAEKQIRLSSERSTWFTAALL
QLSCGHSSEMNQARS----------STTECHKSMNDAVTEAGRESSSSRAASHSISAFGV
SKKLL--------DPKATSLHSSPQA----LASHSSRSRLNG-----------NFAYGGE
CMSADRFLQDSTQRSNYSEQ---------------------------------KVLVNGN
LESLAHIWMRCIENCHSKTLQQLLFDHGKLVCV--------RQCEGCVLAFIAFEDS---
SIRSRAERF---------------------------LSS---------------------
-ITNSIETV--LRCTVEVRMGLL--PD--FIASGLTSE------MGPNVRRAESD-VLSC
SSNSDRLKGTLNTSSRNFDYSDEVKKGLEQFKFASA--GDERLQSASVTSVNS--GKTKA
THMSKI---------------SMIDEQRLESAWLQAAEKH---TPGMVNQTRPD---RHQ
VVPQ------------IVSP-YER-------------RSSMALVVPS----GQE-DEDLS
HGIKAMKIVDSYGVQKDQNGRNVNRNVVSPSK-----LHSDDYYMENCDKE-SIVLNH--
------------------------------------------------SYR--------L
KFIVAR-------------------------K---------------------------L
DDLVALAFSTVGKLKDQ----RG
>gi|125533942|gb|EAY80490.1|	   1232 residues, 50 /line  hypothetical protein OsI_034449 [Oryza sativa (indica cultivar-group)]
--------ML----------VFWLCSYAVWEVA---------------------------
--AYGEAAGGCGMGK----------------------------GGRGNMGGGYGGARSLG
QYITS--VRLLKN-NISLLGQCFLLIITIS------LAPKLWQLWLRGVLVQIGSNVSQK
HIEPAAAPPKGE-----KKRKKVYLYNWRHHSNK--SSESGI----------KLDDDDRQ
ASADCSLESPCISNGVDSRSET--------------------------GLEVPVSIYSVQ
GSNSGTPVTRTVRRVRRSSLSKKGAIR--NSTVSKLL----------DLHV---NSGEQS
EDTDN-YNSENHELLQKGGYFSHSTSPLFAASGCLS-SSNPSKF------LK-VPRREG-
SSFS--CTP-VS--------------------------------------------TS--
SYYRYRGRNPSTVGSWD------GTTAASLDEDGL---NQPELLRSQRCGIPCNWSKRN-
-KHKG------SERS-FSPSL-----SDTLRRKGSSLLCGGQTMHRRK-RS--SGS-SKC
--AYLTKSSQG-TPLLDDSCH--FAYSSFDS--TSDEVSTIFGELDLEALSRLDGRRWSS
--CKSQD-GIAL-PMSGA----DHAVSDQRSLSQKYRPRSFNELVGQSFVVQSLNNAIIR
ERIAPAYLFHGPRGTGKTSAARIFSAALSCV-AIGE--------NKPCGACMECTDFFTG
NGINLIEVDASNRKSINRIRH-LIENIPASAT--SSRYKVFVVDECHMVSSKVWSAFMKF
LDEPL-PRVVFIFITIDPENLPRAVISRCQKYMFSKIKDIDIVCRLRKIAVKENLDVELA
ALDLIALNSDGSLRDAETMLDQ-LSLLGK-KITPSLVNDL--------------VGVVSE
EKLLDLLEIAMSADTAETVKRSRELMDSGVDPMALMSQLAGLIMDIIAGTYRLAD-----
---PTCGGEGIGGRN-------ITDAELERLQQALKILSDAEKQIRLSSERSTWFTAALL
QLGSGHNSEMIQSRS----------SSKQSAKATSEIVMDAVRESSASRTTAHPLFTLRG
SRKTL--------DLRTASGHSSPQG----VVSVSSRMRAND-----------NLKHG-E
CRSVDRVLQDSAQ-----------------------------------------------
-----------------RSNSSELRPMTNDGVQ--------TFNEGYYIAFIAFEGS---
DIKSRAQRF---------------------------TSS---------------------
-IRNSMETV--LRCNVEVRIGLM--PE--LLAGGLKRE------EDLD-ERDEFD-ALSC
STNSDRLKGIRNP-SRNLNYSEEIEKKLEKFSCASASGGLQSCTTEGNTGMHRTRGKEVS
VEQAKA---------------VTVEEQRLESAWLQAVEKH---APGILNQMRPE---RNQ
VVPR------------ISGEQYHR-------------MPETDTVFPS----RQV-DKELS
NGLKSLNIGSHG-LR--QNGQMENGYAISPSL-----LHSNNH-LANCDNE-SVVSEPGA
PGCHGLFPCWKTEK-----------------------SKRRKKKACPLQTL--------L
KSFVQRRFKTRY--------SCLPRSRAHIPK---------------------------F
REFDGLPWCTSQPIQFM----NL
>gi|147856456|emb|CAN80768.1|	   785 residues, 50 /line  hypothetical protein [Vitis vinifera]
--------MV----------VMDPSNFHLQ------------------------------
--------------------------------------------------------KKQL
TQIRK-AARVLRDPGTTSSWRSPLSTAR---------------------SLSLSAATPPP
P-QPPPPPPRPP-----EESKRVFLYNWRSASQKAKSSVNGE----------NEDDEDGV
DGSSVDDSLSDWRNGVDSKSDTYIGGRRHRR--HHASMIFRCRDANLVAMGRPSGIKKKK
GSKNVHSIALL-RHQQQQQQQQLNTAR--SGNSKRLL----------EGILGRDDSVEQS
DDTEEYYNSEDFRRI-------CEASPLLSRLRQRNWSRSSSRL------LR-SKRKDD-
SSYS-YSTPALS--------------------------------------------TS--
SYNPYGNRNPSTVESWD------GTTASLHDGDDEV-DDQLDLPGRQGCGIPCYWSRRST
PRHRG---ICGSGSC-DSPSL-----SDTIRRKGSSMLCGSQTIYPRR-HGLPLGS-KKR
--RSVSMTPQGLLPLLTNSCD-GHGGSSMGTGRSDDELSTNFGELDLEALSRLDGRRWSS
-SCRSQE-AMELVALNGE-REEEGSPENVRSLSQKYRPMFFDELIGQNIVVQSLVNAISR
GRIAPVYLFQGPRGTGKTSTARIFTAALNCL-AVGE--------TKPCGICRECSDFISG
KSRHFREIDGTNKKGMDRMRY-LLKTMPFGTPSPLSPYKVFVIDECHLLPSKTWLAFLKF
LEEPP-PQVVFIFITPDLENVPRTVLSRCQKYLFNKIKEGDIVARLRKISDDENLDVESD
ALELIALNADGSLRDAETMLDQ-LSLLGK-RITTSLVNDL--------------VGVVSD
EKLLELLELAMSSDTAETVKRARELMDSGVDPIVLMSQLASLIMDIIAGTYHIVD-----
---AQQSDSFFGGRS-------REYNPLDY------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------D--IVVSFKVKL------LWPNIL----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------DLYF---------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|30683811|ref|NP_172898.2|	   1116 residues, 50 /line  DNA polymerase-related [Arabidopsis thaliana]
-----MSGLR----------ISDPSKLHL-------------------------------
--------------------------------------------------------KKEL
THIRKVASKGLRDPGTTSSWKSPLTSSRFV--VEPPASNNVEI-----LSNNQLDSQF--
-PSSRVFGNNGK-----EKEKKVFLYNWKTQRTS--SEKT-----------EGEDETSWI
QASLNDDDDDD-----DDVSDARNGGDSCLEETRSASM---I---------RKSGFIKKK
------------SKELDLSIGRKSTAK-----------ARNFPSHHLHVASGLSVVRDES
DETEDFSNSENF--------PTKVSSPLLLKLKRKNWSRSSSKF------LRGTSKRED-
SSHTCNSTPALS--------------------------------------------TS--
SYNMYGIRNPSTVGSWE-------------DGDDELDDDNLDFKGRQGCGIPFYWTKRNL
-KHRG------GCRSCCSPSF-----SDTLRRKGSSILCGSQSVYRRH--RHSSGRFNKQ
--KLALRSAKGVLPLLKYGGD-SRGGSSIGIGYSDDDLSTDFGEIDLEAQSRLDGRRWSS
-CCKSQD-GER----EEE-EEGGSTPESIQSLSQKYKPMFFDELIGQSIVVQSLMNAVKK
GRVAHVYLFQGPRGTGKTSTARILSAALNCDVVTEE--------MKPCGYCKECSDYMLG
KSRDLLELDAGKKNGAEKVRY-LLKKLLTLAPQSSQRYKVFVIDECHLLPSRTWLSLLKF
LENPL-QKFVFVCITTDLDNVPRTIQSRCQKYIFNKVRDGDIVVRLRKIASDENLDVESQ
ALDLIALNADGSLRDAETMLEQ-LSLMGK-RITVDLVNEL--------------VGVVSD
DKLLELLELALSSDTAETVKKARELLDLGADPILMMSQLASLIMDIIAGAYKALD-----
---EKYSEAFLDRRN-------LTEADLERLKHALKLLSEAEKQLRVSTDRSTWFIATLL
QLGSMPSPGTTHTGS----------SRRQSSRATEE---SISRE--------------VI
AYKQR--------SGLQCSNTASPTS----IRKSGNLVREVK-----------LSSSSSE
VLESDTSM--ASHDDTTAST---------------------------------MTLTCRN
SEKLNDIWIKCVDRCHSKTLKQLLYAHGKLLSI--------SEVEGILVAYIAFGEG---
EIKARAERF---------------------------VSS---------------------
-ITNSIEMV--LRRNVEVRIILL--SE--------------------------TE-LL-N
-SKQTRQIAVT-------------------------------------TSSYTESGNEIP
MKRIEA----------------IIQEQRLETEWLQ----K---TPGSQGRLKPE---RNQ
ILPQ-------------EDT----------------------------------------
NGVKVLKICEMGEFQENQSGKRMEHCPVSPSL-----LHNSNF-TNNKDNLG-YESESGR
GVCSLLF-CWNTQK-----------------------SPRRTK---IKGTS--------M
RS--RRSRERRF--------SLF----SACAR---------------------------P
R---------------------K
>gi|7262689|gb|AAF43947.1|AC012188_24	   1071 residues, 50 /line  Contains similarity to DNA Pol III Gamma and Tau from Chlamydia trachomatis gb|AE001306.1 and contains an AAA (ATPase) PF|00004 domain. [Arabidopsis thaliana]
-----MSGLR----------ISDPSKLHL-------------------------------
--------------------------------------------------------KKEL
THIRKVASKGLRDPGTTSSWKSPLTSSRFV--VEPPASNNVEI-----LSNNQLDSQF--
-PSSRVFGNNGK-----EKEKKVFLYNWKTQRTS--SEKT-----------EGEDETSWI
QASLNDDDDDD-----DDVSDARNGGDSCLEETRSASM---I---------RKSGFIKKK
------------SKELDLSIGRKSTAK-----------ARNFPSHHLHVASGLSVVRDES
DETEDFSNSENF--------PTKVSSPLLLKLKRKNWSRSSSKF------LRGTSKRED-
SSHTCNSTPALS--------------------------------------------TS--
SYNMYGIRNPSTVGSWE-------------DGDDELDDDNLDFKGRQGCGIPFYWTKRNL
-KHRG------GCRSCCSPSF-----SDTLRRKGSSILCGSQSVYRRH--RHSSGRFNKQ
--KLALRSAKGVLPLLKYGGD-SRGGSSIGIGYSDDDLSTDFGEIDLEAQSRLDGRRWSS
-CCKSQD-GER----EEE-EEGGSTPESIQSLSQKYKPMFFDELIGQSIVVQSLMNAVKK
GRVAHVYLFQGPRGTGKTSTARILSAALNCDVVTEE--------MKPCGYCKECSDYMLG
KSRDLLELDAGKKNGAEKVRY-LLKKLLTLAPQSSQRYKVFVIDECHLLPSRTWLSLLKF
LENPL-QKFVFVCITTDLDNVPRTIQSRCQKYIFNKVRDGDIVVRLRKIASDENLDVESQ
ALDLIALNADGSLRDAETMLEQ-LSLMGK-RITVDLVNEL--------------VGVVSD
DKLLELLELALSSDTAETVKKARELLDLGADPILMMSQLASLIMDIIAGAYKALD-----
---EKYSEAFLDRRNCEYLKLQMTEADLERLKHALKLLSEAEKQLRVSTDRSTWFIATLL
QLGSMPSPGTTHTGS----------SRRQSSRATEE---SISRE--------------VI
AYKQR--------SGLQCSNTASPTS----IRKSGNLVREVK-----------LSSSSSE
VLESDTSM--ASHDDTTAST---------------------------------MTLTCRN
SEKLNDIWIKCVDRCHSKTLKQLLYAHGKLLSI--------SEVEGILVAYIAFGEG---
EIKARAERF---------------------------VSS---------------------
-ITNSIEMV--LRRNVEVRIILL--SE--------------------------TE-LL-N
-SKQTRQIAVT-------------------------------------TSSYTESGNEIP
MKRIEA----------------IIQEQRLETEWLQ----K---TPGSQGRLKPE---RNQ
ILPQ-------------EDT----------------------------------------
NGVKVLKICEMGEFQENQSEDMNQN-------------------------QG-EE-----
------------------------------------------------------------
-----FAVCFSV--------GTH----KSLQE---------------------------E
P---------------------K

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.