Fandom

Proteins Wiki

At2g02410.1/MSA

< At2g02410.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|30677998|ref|NP_178346.2|	   308 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MKTA-------------------------------------------------------
------------------------------------------------------------
GAPPQRGGSSSSSAVYFNWSSSSCSYDSCRVLVVKMG-------G---------------
-----------KSKKPHQSSSFKESEPEPPRIKSNVKHNLQLLKLW--------------
-----------------------KEFQSRGSGMAKPATSYR-------------------
-------------------------------------KKKVEKDELPDDSELYRDPTNTL
YYTN----------------------------------QGLLDDAVPVLLVDGYNVCGY-
----WMKLKKHF--------MKGRLDVARQKLVDELVSF-S------MV--KEV-KVVVV
FDALMSGL-PTHK----EDFAGVDVIFSGE-TCADAWIEKEVVA----LR-EDGCPKVWV
VTSDVCQQQAAHGAGAYIWSSKALVSEIKSMHK-EVE--KMMQETRSTS--------FQG
RL-----------------------------------LKHN-------------------
-------------------------------------------------------LD-SE
V-VDALKDLRDKLSENE-T-----------------------------------------
----------------------------------------------KR
>gi|106895727|ref|ZP_01362801.1|	   170 residues, 50 /line  Protein of unknown function DUF901 [Clostridium sp. OhILAs]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MKEYLILDGYNVINS-
----WPELERLM--------S-QSLEVARTDLIGKMAEY-R------AY--KGI-NVIIV
FDAYLVKGSNRSN----EKLQGVEIVFTKEKETADAYIERLITQ----LS--SNRNRVSV
VTNDWVEQQMVLGGGATRVSVREMVLEFDQIKN-KIH--KKIESTK-----------KQK
ET-----------------------------------LSDR-------------------
-------------------------------------------------------ID-PA
I-LEKLEKIRRK------------------------------------------------
-----------------------------------------------L
>gi|85860498|ref|YP_462700.1|	   179 residues, 50 /line  hypothetical cytosolic protein [Syntrophus aciditrophicus SB]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MHIIIDGYNLIRQ-
----SDFLRHF---------ERRSLEAGRQALLSQVSSY-R------KS--KGH-RITVV
FDGWENGSPFEER----DRQGGITVVYSRRGEKADEVIKRMVLQ---------KGEEIVV
VTSDRDVADYISRKGATALTSPEFEEVIVRAAASAAVTAVAER-----------------
---------FPEKEE---------------------------------------------
-----EDDARE------------------------------------SGNARKKGPA-HR
LSRREKAAMT--------------------------------------------------
-------------------------------------------RRRKL
>gi|91201690|emb|CAJ74750.1|	   226 residues, 50 /line  hypothetical protein [Candidatus Kuenenia stuttgartiensis]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MLIIIDGYNLIFS-
----VPELEKHV--------ERNFIEAVRDYVISFLSQY-R------QE--KHY-DIIVV
FDGTYSETSLPRR----LVSGGIKIIYSKTGVKADTEIMNIASH----V---KNPKDVCI
VTYDNEIKRHVKKCGCRILDPKSLYREIYDVLFKENNQK---------------------
-----------------------------------------------------PSEPESK
WKGPTEGDAKSWEGVFKEVTREEVDFHIKKTGLANI--KKKQVQVTFENTCKNEHQE-DS
LPDNNTQYWIRLF---EGLE----------------------------------------
------------------------------------------NNDQKN
>gi|111224485|ref|YP_715279.1|	   436 residues, 50 /line  hypothetical protein FRAAL5101 [Frankia alni ACN14a]
--------------------------------MTGPLPASVREYVIELAAQTLADLPESD
VPPSLAAVRRFKASRRAK---VGAIPLAAAVDND-VFRGRVAEWIRRHQPELAEAADSAD
GPPPAAPPEKVAAVAYLLRVPHWPELVELASASAAEAEVRGR-------ADEAERTIRRL
TEQLAAHQRSAADELGQVRERLAAARAEAEETRRRLRASSDRIRRAEEAARESVVAAESV
RDA----ALAAGRDAE----VEVRRLRGRVAELESALAAARRDSRDSRSVDDARMRVLLD
TLIASAHGVRRELDLPTMVARPADLLARGGDGPSSAPQAFVGARGRPDDDPTLIDEV---
-----------------------------------------LAVPGVHLIIDGYNVTKR-
----GY--------------GRLTLQAQRERLLSGLGAL-A------GR-NPDS-EVTVV
FDATAVVARPVGV----TMPRGVRVLFSRPGQLADEEIVRLVRM-------EPQGRPVFV
VTSDREVAENSAAAGARAVPSAALLARLDR------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------
>gi|119358495|ref|YP_913139.1|	   174 residues, 50 /line  hypothetical protein Cpha266_2731 [Chlorobium phaeobacteroides DSM 266]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MKHQEVIIDGYNLMHK-
------QFRSI---------SADNIAALRDKTEHALQRF-Q------LE--HHC-AVTIV
YDGKYDRNES-------VSGIRPRVVFTASSSSADQWIVDYVKS----L--NTRIKKITI
VSSDHEVRLYARAFGANCLTSEAFIAMLDLTRR-AKNSSPGYQQL---------------
------------------------------------------------------------
---------------------------------------------EGYEKNRGKFSD-EY
LSKHEVDEWKRLF---NTGK----------------------------------------
-----------------------------------------------T
>gi|119717350|ref|YP_924315.1|	   425 residues, 50 /line  hypothetical protein Noca_3126 [Nocardioides sp. JS614]
MTEPVLRSLAE-------------------------LPEPVRARVVAMTAEALPDVP--R
LPAAVRRVAGFAPTRRAR---LGGTAIAGALADDD-FRARVGTQVAA------------R
PAPAEDDAAAVAAHRWLTRAEGWETELEDAVR-------RMSERSAPARPDPDDHELERL
RGRLADAEQTLRDLRAAHRSEIGEYKTENAALRRKLGDTRAAEREARAAADEA----GQA
QQAAEALAAERCAVLE----KDNRRLRGQLERLEAEAARGRRDARSERDDATLRARMLLD
TVIDAAAGLRRELALPPVAGAPGDRVEADVA--AAGTREPSAAGALGTSSAALLEQY---
-----------------------------------------LAMPRARLLIDGYNVTKT-
----AW--------------PTTPLEAQRNRLVTALAPL-V------AR--TRA-ETTVV
FDAADTDHRPLV-----HTPRGVKVLFSPRGVIADDVLRDLVAV-------EPEGRVVVV
VTGDRAVAEDVARSGARVISSEALVEVLTR------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------
>gi|121541328|ref|ZP_01673081.1|	   175 residues, 50 /line  conserved hypothetical cytosolic protein [Candidatus Desulfococcus oleovorans Hxd3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MSLHIIIDGYNLIRQ-
----SPVLSRIE---------QENLQAGREALVASLVSY-K------RI--KAH-TITVV
FDGTDAPSYYSHR----DRVGGIDVRFSGPGQTADSVIRKMAAE---------KREKALV
VSSDRGITDFAQSAGAAIIASREFEDRMAQAMMMDAA--GMAEEDGAFSPW---------
------------------------------------------------------------
-----------------------------------------------SGTTKKKGPG-HR
LSKKQRKSRT--------------------------------------------------
-------------------------------------------KAEKL
>gi|134098273|ref|YP_001103934.1|	   428 residues, 50 /line  hypothetical protein SACE_1690 [Saccharopolyspora erythraea NRRL 2338]
--------MRVDWDG---------------------LAGPLRSRLAELAADALGEMRAAD
VPAQLRPVVRFAPAKRAK---LGQAALIAALRDSAVFRTAVVDWCRGERPEALSLTDD--
------DPVVVAAAAVLQESPVAAHYVELVALRTEQGQLRGERDSAATRAEKLAAEAERL
RAELAEAKVAVE-------RACGQNSAEADRLRKRLREQGVRLKEAKDDAEAARADLERV
REDADA-AIAEIAAERDRELARAREERLRADRAAADAETARHSAREARQGDEVRLALLLE
TLDGALGGLRRELGATGSGPRPADVVQRVRS--HSGATGQ-------VQDVAALDRL---
-----------------------------------------LALPAVHLIVDGYNVTKT-
----GY--------------PELPLADQRDRLAHQLAAL-A------AR--TGA-EVTLV
FDGADVLAVPA------AGPRGVRVLFSEPGVQADDVIRDLVAA-------EPQGRQLVV
ATSDRAVVESVRRRGAYAVPSAILLSRLHR------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------V
>gi|138893767|ref|YP_001124220.1|	   170 residues, 50 /line  Hypothetical cytosolic protein [Geobacillus thermodenitrificans NG80-2]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MNILIVDGYNIIGA-
----WPVLRQLK--------EEGDLAAARDLLIDKMADY-K------GF--TGD-HVMIV
FDAHLVPGN-EKK----YKNYDVDVIFTKENETADERIERLAKT----LM--NARTKVYV
ATSDYTEQWTVFSQGALRKSARELLYEIEAVER-DIS--KKLKEIK-----------QHT
PI-----------------------------------SKMP-------------------
-------------------------------------------------------LN-DR
V-AEIFEKWRR-------------------------------------------------
---------------------------------------------GQK
>gi|139438526|ref|ZP_01772042.1|	   225 residues, 50 /line  Hypothetical protein COLAER_01035 [Collinsella aerofaciens ATCC 25986]
-----------------------MSKKNRAKSKAKRFGEGSAK-----------------
------------PIVSAATYGVGGNAFAQAIA----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------DPVST--------------------------------
----------------------------------------VHSNKPELLVVDGYNVIHC-
----TPRYEKLVYDHSDDPYSSDVHDMARTALINDVAAF-A------QG---RY-EAVIV
FDGAGNISSERPN----LPARGVRIEFSPTGVSADTVVQKLCIE----A--REEGRACSV
VSSDGTIQAVVMGKGVTRISSRMLVDEIKQIDN-DVH--EAEEAP------------QIK
MT-----------------------------------LGSR-------------------
-----------------------LSPDAL-AKLKAL------------------------
---------RG-------------------------------------------------
-----------------------------------------------R
>gi|145345031|ref|XP_001417027.1|	   374 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
-MTTSGTSTSRSTRRRRGDVAARASKGKRREGDDRGARDASSTPP---------------
------------PRITKR---TNGMSVATQIKLVERFKS---------------------
--LSGGDGSNANARANAGRGTSGTSAKPIEGGR-RKG-------ADGTRDRTYEA-----
--ELARRRAEKKRE-------------------ARLRSELERFSGG--------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------GEPPLLLVDGYNVCGLE
GADGVEEANAAF--------RRGDMDAARVALTKEVMDF-K------SF--SGY-AVALV
WDADRNRDKDEDEIEGDLDVDGFMTVYSVK-NDADSWIEARVAQEIGAD--KKSNRVVYV
ATSDNALSSIARGTGAYVVTAKAFVEELRKASQ-GEK--EILQEMAIAA-----------
---------------RWNSSKKMSNVGVRDDDVKRKLLE-MYKTAPNMEAPANAPKGDFK
RHSETT----------------------------------------------------KM
KQAPKAPKWAEMR---TAQR----------------------------------------
-------------------------------------------RQNKP
>gi|15896401|ref|NP_349750.1|	   172 residues, 50 /line  Uncharacterized conserved protein, YACP B.subtilis ortholog [Clostridium acetobutylicum ATCC 824]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MKTILVDGYNVINS-
----WGKLNSIK--------DDVSLESARDKLIEVLVEY-G------EF--TNC-KIIVV
FDAHHIPGNTGEKI---KMYDKFTIVYTKAGETADSFIERYVNK----VG---RKSEVCV
VTSDNLEQQVVFQRGSTRMSSIEFYNDVQKIHG-RIS--KKAEKIRNE------------
--------------------------------KKYNRLEDR-------------------
-------------------------------------------------------ID-KN
I-MEKLDKIRKN------------------------------------------------
-----------------------------------------------L
>gi|21220614|ref|NP_626393.1|	   447 residues, 50 /line  hypothetical protein SCO2137 [Streptomyces coelicolor A3(2)]
MVETHGG----------------GPGDGAAEVLDRPLPDGVRRRVVQIVSDGFGSLTLGE
LPAQLRQYARFAPNRRIK---FAGNAMAAAVETDPLFRQRIGEKFRDVQSELADALDA-G
SALPAADPLDVAAAAYVLRPHGWVKLVTAAGEEAQRA-------DAERADEESRAELERL
HEELSRAREHTRTETERLRGELDAAKRETESLHRKLRSALSDVKRGEAALRKVQAELDAV
R---AE-GQTQVSAAE----SETRRLKARLGEAEAALEATRRAAREGRSVEDMRVRLLLD
TLLDATQGLRRELALPPVSVRPAETVDAVEP--GRMTPKDIANRALSENDPAILDQL---
-----------------------------------------LALPQAHLVVDGYNVTKT-
----GY--------------PQMPLEKQRLRLLGQLSQL-A------AQ--TGA-EMTCV
FDGAELVAPVLL-----APPRGVRVLFSKPGVTADELIRQLVRA-------EPPGRPVIV
VSTDREVADGVARAGARPVASVVLLKRL--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------S
>gi|67918612|ref|ZP_00512208.1|	   164 residues, 50 /line  conserved hypothetical protein [Chlorobium limicola DSM 245]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MKHNELVIDGYNLLHK-
----LC--PAS---------AGTALDELRRKMETTLRSF-Q------LR--RKC-SITVV
YDGSGI----RDS----SCGNTLHTIYTASSKTADAWIIDYVKS----L--NTSRKMVTI
VSSDREVTLYGKAYGAKCLTSEEFIGLLEKSRP-PAG--KNDR-----------------
------------------------------------------------------------
-------------------------------------------------DYNSKYTN-GF
LDSNEVKKWKHLF---ESG-----------------------------------------
-----------------------------------------------R
>gi|72161432|ref|YP_289089.1|	   449 residues, 50 /line  hypothetical protein Tfu_1028 [Thermobifida fusca YX]
MTDDSGN------------AEERGPEHADDETLDRPLPEAVRTRVIEYGAEILGMMLPTE
IPPRLRRIAKFEPRRRAR---LAGPDIAAQLEADAEFRSRVAERMRQAWPSLVAELDQ-G
ELPPAVDPVIAGAVLYVLRPPGWAATVQQIHDELERE-------ARAKAADDTAETLVEL
QTKLDEIKTQHRQEVLRLRAELREHKAEIAELRRKLHHERQRAKEAVRGAERSIAEAQEH
S---DA-AAARLHAVE----AENRRLRNRLAAAEAQVENARRAARAARGAEEARLRVLLD
VLQEAAQGLRRELALPASITLPADLVAAE----ARSGTAEMPGQGLPDDDPKFIDQL---
-----------------------------------------LTIPRIHLLVDGYNVTKT-
----GY--------------GDRPLADQRAKLLAGLEGL-A------SQ--TKA-EITCV
FDGAEIDSPIAL-----VNSRRVRVLFSSPGETADELIIRLVRA-------EPEGRPVAV
VTSDKEIIAAVRREKARTVASPLLLRRL--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------E
>gi|108804990|ref|YP_644927.1|	   169 residues, 50 /line  protein of unknown function DUF901 [Rubrobacter xylanophilus DSM 9941]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MAQYLILDGYNLIGA-
----LERYGTGK--------T-GGLDESRERLVNDALKA-A------GW--TGR-RVIVV
FDAHGSPEPEREEV---RAGGAVRLVFSGPGQSADDVIERLLSR----LE--E--GSATV
YTGDFALQRTVLARGARRATPREFQGLLDELPA-VVR--SPDR--------------SRR
SK-----------------------------------VADR-------------------
-------------------------------------------------------LS-PE
T-LRRLEEIRRRAAG---------------------------------------------
-----------------------------------------------D
>gi|113938170|ref|ZP_01424040.1|	   265 residues, 50 /line  hypothetical protein HaurDRAFT_3816 [Herpetosiphon aurantiacus ATCC 23779]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MPYIIDGHNLIGQ-
----LATIR-----------LND--PDDEAKLVQLLQRF-A------IT--RKV-SVSVV
FDRGQYTQ---GS----LGGGGVSVRFARSPSDADEIIKSQLVR----LS--RP-SEWVL
VSSDRAITSVADAVGARVITARDFAALLESMGA-ADPNAPTHQEMHAH---------VRQ
DQLPEWLDFFGIDKESAESKVDLTRKPKPNQPTQQRSATQAKRRSPQAAKPIVVPQPPER
WQLPPR-------------RKDQPDPIPR-DADGRPRLSRGGKNPQASTGERLHKPP-PP
VHPDEIDEWLEFF---GAD-----------------------------------------
----------------------------------------------EQ
>gi|118443709|ref|YP_877181.1|	   168 residues, 50 /line  hypothetical protein NT01CX_1097 [Clostridium novyi NT]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MRNVFVDGYNVINS-
----WPELNRIK--------E-YSFEAARDKLIEIMQNY-G------AY--NGY-KIFLV
FDAHLVKGSIEKK----ERMSNLMVVFTKEGETADSFIERYVNN----IG--RK-VEVCV
VTSDSLEQQVTFQRGATRMSSIEFYNEVKTTTQ-K-------------------------
----------------------ITNKTKKNISANRTLLEDR-------------------
-------------------------------------------------------ID-KK
V-LEKLQKI-------RK------------------------------------------
-----------------------------------------------S
>gi|32474373|ref|NP_867367.1|	   176 residues, 50 /line  hypothetical protein RB6627 [Rhodopirellula baltica SH 1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------M-
----APPSRGAS--------P-NWLHDERQLLLNRLSEHLT------DP--IRS-RTCVV
FDARNPPHGVSDQ----MIFADMDVRFAVGYPEADDLIEELIFE----HP--NP-KSLTV
VSSDHRLHAAAKRKKALPIDSDVWLDALLDGHI-Q-------------------------
----------------------MAKLPKATSKRKRHKKSDRKSGEPSA------------
-----------------------------------------------DASPSGPTLD-AM
LETEELQKWLDQY---GS------------------------------------------
-----------------------------------------------D
>gi|81429290|ref|YP_396291.1|	   177 residues, 50 /line  hypothetical protein LSA1678 [Lactobacillus sakei subsp. sakei 23K]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MKKQILIADGYNIIGN-
----WPELNKLK--------QNDHLADARDSLLQTLSEY-R------KF--REI-EIILV
FDAMYVPGI-KQS----YEQYNLEVVFTEEDETADSYIEALAGK----LM--SPINQVTV
VSSDQAEQWTIFSRGALRVSSHDFYREIKRTHR-E-------------------------
----------------------IDHDAKRY-HSKVMQRNRP-------------------
-------------------------------------------------------WN-DD
Q-LERLAQMRDQLSDEKN------------------------------------------
-----------------------------------------------D
>gi|68550371|ref|ZP_00589821.1|	   186 residues, 50 /line  conserved hypothetical protein [Pelodictyon phaeoclathratiforme BU-1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MPI
FRMN----------------------------------TTPMKRGAKEILIDGYNLIHK-
----LH---PSL--------TSASLDVLRKETETQLLCF-Q------QK--TEC-PITVV
YDGKGSP---RES----ACGAPLHIVFTSASKSADHWIIDYVKS----LN--TRVKKVTI
VSSDDEIRRYATAFGATCVKSETFALQLNELTA-D-------------------------
----------------------AAVQDKSRHSLRMTVKEK--------------------
-----------------------------------------------------KFND-KL
LSEREVSRWMKLF---ARE-----------------------------------------
----------------------------------------------KS
>gi|20808678|ref|NP_623849.1|	   167 residues, 50 /line  predicted RNA-binding protein containing a PIN domain [Thermoanaerobacter tengcongensis MB4]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MPLYMLVDGYNVINN-
----WQMLKEIA--------K-RSLEDARDKLIDLLADF-K------GY--TGI-NIILV
FDAMYVKGSLEKH----EEINGIEVVYTKEGESADHFIESKVVE----LV--KK-EDVVV
VSSDWIVQQVVMAHGAIRMSARELYEEMNRYIE-KHK-----KEYMNT---------FYK
DN-----------------------------------LENR-------------------
-------------------------------------------------------LD-EE
T-VKKLRQM-------RE------------------------------------------
-----------------------------------------------N
>gi|56752454|ref|YP_173155.1|	   183 residues, 50 /line  hypothetical protein syc2445_c [Synechococcus elongatus PCC 6301]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MPL
LQ-----------------------------------------IMSALLLVDGYNVIGA-
----WQHLQQLR--------DRHGLEAARTELVELLSNY-S------AY--QGY-LTNVV
FDAQYRATPGQQE----QVTEQLVVSYTDSEQTADTYIEMTCASHRDALR--TARQRVIV
ATSDRAQQLTVIGFGAEWMSTHRLALDVEASIQ-KVR--QWQAQQRRK---------HQP
KT-----------------------------------LGSR-------------------
-------------------------------------------------------LD-DR
V-RRQLEHWRRQ------------------------------------------------
-----------------------------------------------S
>gi|86609568|ref|YP_478330.1|	   180 residues, 50 /line  hypothetical protein CYB_2120 [Synechococcus sp. JA-2-3B'a(2-13)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
QA-----------------------------------------SSSTFLLVDGYNIIGA-
----WPTLNQLA--------RRSLMELARLRLVESLANY-V------AF--RGY-QATVV
YDAYAQPTPARQE----RSPSGIEILYTSYGETADSCIERLCAQ----LQ--KDGCRVRV
ATSDRVQQLVIGGYNAEWVSAEQLWDEVQQAQQ-QIR--HLQP--KRL---------SSK
RG-----------------------------------IDAY-------------------
-------------------------------------------------------LD-AE
T-LSRLNRWRLSGQDP--------------------------------------------
----------------------------------------------MR
>gi|124515025|gb|EAY56536.1|	   178 residues, 50 /line  hypothetical protein UBAL2_80620182 [Leptospirillum sp. Group II UBA]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MGHIVLIDGYNVIGS-
----EGRFRK----------DRDILARERENLIRRLSEY-R------SLLAPDT-EIQLI
FDGFPSDRE-PFG----HRGGGVTVVFSEEEGSADAVIVRLSER----W-----GNRAIV
VTSDREVILRVRQSGAQAVGAREFMDRVGARRT-ATS-----------------------
------------------------HTIRNG------------------------------
--KPED-------------KDEDEDPRPQ-TKKG----------------------N-PR
R-LSKKERARRRTL----L-----------------------------------------
----------------------------------------------NL
>gi|146296391|ref|YP_001180162.1|	   167 residues, 50 /line  protein of unknown function DUF901 [Caldicellulosiruptor saccharolyticus DSM 8903]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------MVDGYNFINA-
----WSKLKEIA--------K-DDLEVARKKLIDILADF-S------GY--KGY-RITVV
FDSHLVKGAQRKK----EVINNIEVVFTKEGETADNYIEKYVYE----NA--K-YESIAV
VTSDYLEQLMILGNGAVRMPPRELIYEIENYKK-ELE--KKTN--EKI---------RRK
DR-----------------------------------LEDT-------------------
-------------------------------------------------------LD-SS
I-LEKLEKFKKRLDQ---------------------------------------------
-----------------------------------------------A
>gi|70727475|ref|YP_254391.1|	   175 residues, 50 /line  hypothetical protein SH2476 [Staphylococcus haemolyticus JCSC1435]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MKDKYLIIDGYNMIGQ-
----SPELGKIA--------K-DNLQEAREQLLDAIANY-N------AV--VAD-EIVCV
FDAYEQSGI-ERE----YIYHGVKTVFTKEKETADSYIERYVYN----LY-NKHTTHITV
VTSDMSEQHAIFGAGAYRVSSREMWRDLRENEI-TVS--KSLD--DFT---------ESK
PR-----------------------------------TRIS-------------------
-------------------------------------------------------LS-ND
V-LAEFEKIRRGNH----N-----------------------------------------
----------------------------------------------KD
>gi|121535682|ref|ZP_01667486.1|	   172 residues, 50 /line  protein of unknown function DUF901 [Thermosinus carboxydivorans Nor1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MNTTLIVDGYNVINA-
----WPELAALK--------E-DSLEHAREKLLEILAGY-G------AY--KGY-RVIIV
FDAHAVAGMESVE----QITPDLEVVYTSEGQTADSYIEKMVYY----LV--RQGHRVYV
VTSDWAEQMVILGAGAFRIPARELWQNVQEMKR-DVA--DKYGETVLT---------YRR
HE-----------------------------------LGSR-------------------
-------------------------------------------------------LN-HE
V-VRRLNELRRG------------------------------------------------
-----------------------------------------------R
>gi|134298075|ref|YP_001111571.1|	   170 residues, 50 /line  protein of unknown function DUF901 [Desulfotomaculum reducens MI-1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MRDFYVVDGYNIIHA-
----WPEYENMI--------G-TGLDHCRDRLIDILANF-A------GL--DGS-SVTVV
FDAHLVKSGMGHH----EIIHGIEVYYTQEGETADSLIERIVGD----LG--KQ-GNVYV
VTSDWDEQKVIFGRGAYRLTPKEFRTQVLKTNK-RGR--EDYN--KPN---------PTE
GY-----------------------------------LEDK-------------------
-------------------------------------------------------LP-ND
I-RIILEKWRRR------------------------------------------------
----------------------------------------------KN
>gi|68552715|ref|ZP_00592101.1|	   175 residues, 50 /line  conserved hypothetical protein [Prosthecochloris aestuarii DSM 271]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------MSRFHREFIIDGYNLLHA-
----RGL--QAP---------ALTLEEQRTRLEANLIRA-Q------ER--KHC-KITVV
YDGRSHGRAL-------SEAGALNKVFTASKMTADEWIIDFLRS----SP--KRARQLTV
VSSDRLIVSHASAYGAACMSSEAFASSHLEESP-TKRNN---------------------
------------------------------------------------------------
---------------------------------------------TARSEHAGKHGD-KP
LSDREVNAWMKLF---DKENG---------------------------------------
-------------------------------------------RKGSL
>gi|126697622|ref|YP_001086519.1|	   175 residues, 50 /line  hypothetical protein CD0056 [Clostridium difficile 630]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------MKKNINHYLIIDGYNIINA-
----WDNLKELA---------KEDLEDSREKLIDDIIEF-S------EF--MGY-KTIIV
FDAYNVKNSREKV----EKRKHITIVYTREHQTADSYIEKFITS----L---SKYDDVKV
ATNDYAEQQMILGKGATRMSARELKLELDRSKN-KMK--EKNIGLR--------------
------------------------------KKIQRNWLEER-------------------
-----------------------LDKETL-SKLENI---------RR-------------
------------------------------------------------------------
----------------------------------------------KR
>gi|46445718|ref|YP_007083.1|	   222 residues, 50 /line  hypothetical protein pc0084 [Candidatus Protochlamydia amoebophila UWE25]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------MQSSREQFILDLDKK-I------SI--LKI-DVSIV
FDGTFQEGE-GTR----SHFNNVEILFTAQGETADEFILDALKY----S---SQPQQEII
ITSDKKLAKLARNKQAQTESVENFIQWLNKAYKNKLK--KLTNRSKFFNPVTTPKTSIPS
NPSNPKVD------QKIEGSTDYYQQIFENEYQKLLKKEPA-------------------
-----------------------LDKKTP-SKSRKP---------KEKEDPFPKIPPLAI
DAPTQMERWEKVF---EARLK---------------------------------------
-----------------------------------HFSYQD---VEKS
>gi|83591296|ref|YP_431305.1|	   166 residues, 50 /line  Protein of unknown function DUF901 [Moorella thermoacetica ATCC 39073]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MDVLIVDGYNFLHN-
----WPELTRLK---------ESSFDHARDKLITELINY-Q------AY--WGG-KVIVV
FDAHKVPGAVEKR----EKLGGVEVIYSGEGETADAVIERLVGD----I---TETGQVYV
ATSDWAEQRMILGKGALRLPVSELKVYLEQARQ-EIA--RASEG----------------
-------------------------------DPGNGRLDTR-------------------
-----------------------IHQATR-KI----------------------------
-----LERWRR-------------------------------------------------
-----------------------------------------------G
>gi|145220564|ref|YP_001131273.1|	   171 residues, 50 /line  hypothetical protein Cvib_1763 [Prosthecochloris vibrioformis DSM 265]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------MNQRGREIVVDGYNLLHA-
----L--YHPAP---------STPLEPFRRKLEQRLLHF-Q------TV--RRR-TLTLV
YDGDGRHGD---S----STHSPLHIVFTSRRKSADRWIVDYVKS----L--NPRVKMVTI
VSSDEEIRRYASAFGAECIKSETFASMLTPRSG-RKG--DGGE-----------------
------------------------------------------------------------
-----------------------------------------------REDNRKKFSS-DE
LTGDEVERWKLLF---KRKQD---------------------------------------
-----------------------------------------------G
>gi|37522562|ref|NP_925939.1|	   174 residues, 50 /line  hypothetical protein glr2993 [Gloeobacter violaceus PCC 7421]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MQTILLVDGYNVVGA-
----WPRLARLR--------DRHSLEAARNELVEQLAGY-A------SF--RGY-RAVLV
FDAQLVTSPLVRA----SETPHLEVCFTDYEQTADSFIEQYSYQ----LLRENRRRRVMV
ATSDRAQQVLVLAQGADWLSSEQLLKEVEAARR-QLR--EDLRNR---------------
------------------------------KARPSNKLADR-------------------
-----------------------LDPTVR-DK----------------------------
-----LARWRF-------------------------------------------------
----------------------------------------------GE
>gi|78044732|ref|YP_361139.1|	   168 residues, 50 /line  hypothetical protein CHY_2334 [Carboxydothermus hydrogenoformans Z-2901]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MAEYVLIDGYNLLFN-
----WPELNKLK--------DETSLEHAREVLKERLINY-R------AL--TGR-EVIIV
YDAHQQKESR-RE----FFEAGITVVFTESGETADHFIEKKVQE----L---LPGNRVYV
VTQDELQQKLIFGYGALRISLRELLNDLKIEEK-KAK--ELLN-----------------
-------------------------------KVLPQRLEDR-------------------
-----------------------IDQQVK-TKLEKL---------RK-------------
------------------------------------------------------------
---------------------------------------------GKM
>gi|78187962|ref|YP_376005.1|	   170 residues, 50 /line  hypothetical protein Plut_2120 [Pelodictyon luteolum DSM 273]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------MSHRQKETVVDGYNLIHH-
----L--FRPA---------AGASFEPLRRRLESLLTGY-R------RT--RKT-PVTVV
YDGDGRY---RDH----DETGEVHIVYTARRKSADRWIIEYAKS----L--NTSAKILTI
VSSDNEVRRYSAAFGAECMSSADFASMLQPGGT-GDK--PSGE-----------------
------------------------------------------------------------
-----------------------------------------------SGLNRRKFSA-NP
LPEREVDGWMRLF---GGND----------------------------------------
-----------------------------------------------A
>gi|21675034|ref|NP_663099.1|	   176 residues, 50 /line  hypothetical protein CT2225 [Chlorobium tepidum TLS]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------MIMSSTYRETVVDGYNLIHK-
----LG--KAG---------PGASMADLRERLEAMLARY-R------QK--ARR-HVILV
YDGGSGPKP---L----TLTGAVDVTFSGTVKSADRWIIDHVRS----L--GVRATMTFV
VSSDREIQRYSKAYGAKCVDSETFIDELAAMGI-AID--KDGRRK---------------
------------------------------------------------------------
-----------------------------------G---------QQSGVKMNKNAS-GL
LSDKEVDYWLGLF---ARK-----------------------------------------
-----------------------------------------------R
>gi|67938399|ref|ZP_00530925.1|	   167 residues, 50 /line  conserved hypothetical protein [Chlorobium phaeobacteroides BS1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MFREFIVDGYNLLHK-
----L--FPEK---------AQGSLQHKREKTERMLLGF-Q------QS--TRW-KVTIV
YDGQHSRAPF-------QDSGALNRVFTASGGSADEWIIDYLKS----L--GSNAQMFTI
ISSDRFICRHASARGASYMLSEDFIRQYLSGKD-RRD--KTGK-----------------
------------------------------------------------------------
-----------------------------------------------NGSNKEKSSD-VS
LSRKEVDHWLSIF---GKTE----------------------------------------
-----------------------------------------------E
>gi|87310857|ref|ZP_01092983.1|	   254 residues, 50 /line  hypothetical protein DSM3645_18126 [Blastopirellula marina DSM 3645]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MPLIIDGYNLLYA-
----AGVVSSLD--------GNGSFEQDRLMLLELIRSI-V------DP--QEIRQTVVV
FDSAKAPPGLPRT----VRYHDIVVHFASEYADADEMIEVLIEH----H---TAPKRLTV
VSSDHRVQRAARRRKATAIDSGQWISLMRRKRQ-AQN-----------------------
------------------------------------------------------------
-----------------------------------------------RAAELPAKPQ-AP
PSQSEVARWMREF---SEIDVDQIARELKPLRTPNRPPAAPKSPPPSAAKPARPGDSEEP
EVDNPFPDGFEEDIRQLGNQLGGSVFPADYLDQIAREFFDDDDGKSPG
>gi|118064850|ref|ZP_01533166.1|	   164 residues, 50 /line  conserved hypothetical protein [Roseiflexus castenholzii DSM 13941]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MPLLIDGHNLIAQ-
----MPGMHL-SDAD--------D----EAQLVLLLRRY-A------AL-RRGR-TIIVV
FDHGV-YGHPQYL-----DGYGVTCCFARSPQDADAHLIRRINA----ID--RP-RAWTV
VTADRRIAQAAMTRGIKVVDSRTFAQTLLQSANPPR------------------------
------------------------------------------------------------
-----------------------------------------------RQQRVDTEKP-EQ
ADHSEVEEWLRLF---GEKEG---------------------------------------
------------------------------------------EHL--S
>gi|119884149|ref|ZP_01650395.1|	   177 residues, 50 /line  hypothetical protein SareDRAFT_2230 [Salinispora arenicola CNS205]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MSV
LRCSARHGRQGLPGSRRDKLRRRPTPGVRGCGWIGW-QAGGMNG-TPLLIVDAANVVGS-
----RPDGWW-RDRA--------G---ATVRLRDSLARL-AGSGVPPEL-PPPV-EVVLV
VEGAA-RKVP--------PVSGVRVV--AAERSGDDAMVDLVAT-----N--PQ-RRRVV
VTADRELRERVTRRGAEVYGPRWLTGRLVDPH-GS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------C
>gi|76260224|ref|ZP_00767863.1|	   164 residues, 50 /line  conserved hypothetical protein [Chloroflexus aurantiacus J-10-fl]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MPILIDGHNLIGQ-
----MPDIEL-SDPD--------D----EAKLVAKLRRY-V------AK-KRGR-KIVVV
FDGGV-YGHPQNL-----NGFGVETRFVKPPQNADHELIRQIRA----IR--RC-DEWLV
VSSDRAVVGEAQARGIRVMSAQEFARRLQMLD-QPR------------------------
------------------------------------------------------------
-----------------------------------------------INAR-DKRGD-RP
LSKAEVEEWLRFF---GVDED---------------------------------------
------------------------------------------EDTLYY
>gi|24214957|ref|NP_712438.1|	   209 residues, 50 /line  hypothetical protein LA2258 [Leptospira interrogans serovar Lai str. 56601]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MPD
VKFVDPDRKTFG-----ISHFTYNLSRKDGLQYLREWDFGHYNSMLFQVAIDGFNLIYK-
----FPDLEESMYQN--------RLSDARRTLLEWIELY-S------KK-KKKQ-NFHIF
FDGKKEIGNEVLQ----ETFGKLNVYYS-RDRKADDLIKEFVRT----QI--RP-ADVQV
VSSDKEIFYHAKKWGAHPITSEEFASIVTAEIFPSK------------------------
------------------------------------------------------------
-----------------------------------------------QKTDLEELKD-KK
LSSEELEYWKNLF---RKG-----------------------------------------
-----------------------------------------------K

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.