Fandom

Proteins Wiki

At2g02090.1/PDB

< At2g02090.1

47,922pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g02090-1z3i_X.pir.txt

======================================================

Assigned types to 763 residues in Sequence 2-02090, 27 remain unknown
Assigned types to 507 residues in Sequence 1z3i_X, 283 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 234  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 235  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 236  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 237  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 265  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 266  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 267  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 268  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 304  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 305  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 431  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 432  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 433  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 434  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 435  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 436  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 437  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 438  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 439  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 440  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 441  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 442  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 443  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 444  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 445  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 627  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 682  All residues are positively and negatively charged

Translated sequence file At2g02090-1z3i_X.pir.txt into sequence alignment.

======================================================

>1Z3I.pdb  Made from 5052 ATOM records in 1Z3I.pdb
LGLRRAGVRKALHDPFEDGALVLYEPPAISAHDLIKADKEKLPVHVVVDP
VLSKVLRPHQREGVKFLWDCVTGRRIENSYGCIMADEMGLGKTLQCITLI
WTLLKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKWLGGRVQPVAIDGGS
KDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDE
GHRLKNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGIL
GTAQEFKKRFEIPILKGRDADASDKDRAAGEQKLQELISIVNRCLIRRTS
DILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPVESLQTGKISVSSL
SSITSLKKLCNHPALIYEKCLTGEEGFDGALDLFPQNYSTKAVEPQLSGK
MLVLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTM
SIKKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNP
ANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKILQRQAHKKALSSCVVD
EEQDVERHFSLGELRELFSLNEKTLSDTHDRFRCRRCVNGRQVRPPPDDS
DCTCDLSNWHHCADKRGLRDPVLQASWDAAVSFVFHQRSHEDQR

======================================================

Best alignment:
1Z3I.pdb    49  DPVLSKVLRPHQREGVKFLWDCVTGRRIENSYGCIMADEMGLGKTLQCIT    98
                D     +L+P+Q  GV FL   +  + IE   G I+ADEMGLGKT+Q IT
2-02090    206  DSDFQPILKPYQLVGVNFLL-LLYKKGIE---GAILADEMGLGKTIQAIT   251

1Z3I.pdb    99  LIWTLLKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKWLGGRVQPVAIDG   148
                 +  L + + D  P     +VV P+S++ NW  E+ KW       +   G
2-02090    252  YLTLLSRLNNDPGPH----LVVCPASVLENWERELRKWCPS-FTVLQYHG   296

1Z3I.pdb   149  GSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAE-------VLHKG   191
                 ++    S+ +N +S+ G   P  +L++ Y  F  H+E       VL + 
2-02090    297  AARAAY-SRELNSLSKAGKPPPFNVLLVCYSLFERHSEQQKDDRKVLKRW   345

1Z3I.pdb   192  KVGLVICDEGHRLKNSDNQTYLALNSM--NAQRRVLISGTPIQNDLLEYF   239
                +   V+ DE H LK+ ++  +  L S+  NA +R++++GTP+QNDL E +
2-02090    346  RWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHELW   395

1Z3I.pdb   240  SLVHFVNSGILGTAQEFKKRFEIPILKGRDADASDKDRA-AGEQKLQELI   288
                SL+ F+   I  T     K+     L   D +   + ++  G   L+ L 
2-02090    396  SLLEFMLPDIFTTENVDLKKL----LNAEDTELITRMKSILGPFILRRLK   441

1Z3I.pdb   289  SIVNRCLIRRTSDILSKYLPVKIEQVVCCNLTPLQKELYKLFLK-QAKPV   337
                S V + L+ +   +    +  K E      +   +       +K  +K +
2-02090    442  SDVMQQLVPKIQRVEYVLMERKQEDAYKEAIEEYRAASQARLVKLSSKSL   491

1Z3I.pdb   338  ESLQTGKISVSSLSSITSLKKLCNHPALIYEKCLTGEEGFDGALDLFP--   385
                 SL          +  T  +K+ NHP LI  +  + E+    A  L P  
2-02090    492  NSLAKALPKRQISNYFTQFRKIANHPLLI-RRIYSDEDVIRIARKLHPIG   540

1Z3I.pdb   385  ---QNYSTKAVEPQLSG------KMLVLDYILAMTRTTTSD---------   417
                      S   V  ++ G        L+  Y +  T+ T SD         
2-02090    541  AFGFECSLDRVIEEVKGFNDFRIHQLLFQYGVNDTKGTLSDKHVMLSAKC   590

1Z3I.pdb   417  ---------------KVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSI   452
                               +V++ S +T  LD+ E         Y RLDG+  +
2-02090    591  RTLAELLPSMKKSGHRVLIFSQWTSMLDILEWTLDVIGVTYRRLDGSTQV   640

1Z3I.pdb   453  KKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPAN   502
                  R  IV+ FNN  S  F  +LS++AGG GLNL GA+ +++ D D+NP  
2-02090    641  TDRQTIVDTFNNDKS-IFACLLSTRAGGQGLNLTGADTVIIHDMDFNPQI   689

1Z3I.pdb   503  DEQAMARVWRDGQKKTCYIYRLLSTGTIEEKILQRQAHKKALSSCVVDEE   552
                D QA  R  R GQ K   I+RL++  T++E I +    K  L + V++  
2-02090    690  DRQAEDRCHRIGQTKPVTIFRLVTKSTVDENIYEIAKRKLVLDAAVLESG   739

1Z3I.pdb   553  QDVE   556
                  V+
2-02090    740  VHVD   743

======================================================

Highlighted IDENTICAL residue ASP  140  index1   49  path  206  %Seq 100.00
Highlighted IDENTICAL residue LEU  147  index1   56  path  213  %Seq 100.00
Highlighted IDENTICAL residue PRO  149  index1   58  path  215  %Seq 100.00
Highlighted IDENTICAL residue GLN  151  index1   60  path  217  %Seq 100.00
Highlighted IDENTICAL residue GLY  154  index1   63  path  220  %Seq 100.00
Highlighted IDENTICAL residue VAL  155  index1   64  path  221  %Seq 100.00
Highlighted IDENTICAL residue PHE  157  index1   66  path  223  %Seq 100.00
Highlighted IDENTICAL residue LEU  158  index1   67  path  224  %Seq 100.00
Highlighted IDENTICAL residue GLY  172  index1   81  path  238  %Seq 100.00
Highlighted IDENTICAL residue ILE  174  index1   83  path  240  %Seq 100.00
Highlighted IDENTICAL residue ALA  176  index1   85  path  242  %Seq 100.00
Highlighted IDENTICAL residue ASP  177  index1   86  path  243  %Seq 100.00
Highlighted IDENTICAL residue GLU  178  index1   87  path  244  %Seq 100.00
Highlighted IDENTICAL residue MET  179  index1   88  path  245  %Seq 100.00
Highlighted IDENTICAL residue GLY  180  index1   89  path  246  %Seq 100.00
Highlighted IDENTICAL residue LEU  181  index1   90  path  247  %Seq 100.00
Highlighted IDENTICAL residue GLY  182  index1   91  path  248  %Seq 100.00
Highlighted IDENTICAL residue LYS  183  index1   92  path  249  %Seq 100.00
Highlighted IDENTICAL residue THR  184  index1   93  path  250  %Seq 100.00
Highlighted IDENTICAL residue GLN  186  index1   95  path  252  %Seq 100.00
Highlighted IDENTICAL residue ILE  188  index1   97  path  254  %Seq 100.00
Highlighted IDENTICAL residue THR  189  index1   98  path  255  %Seq 100.00
Highlighted IDENTICAL residue LEU  194  index1  103  path  260  %Seq 100.00
Highlighted IDENTICAL residue VAL  210  index1  119  path  276  %Seq 100.00
Highlighted IDENTICAL residue VAL  211  index1  120  path  277  %Seq 100.00
Highlighted IDENTICAL residue PRO  213  index1  122  path  279  %Seq 100.00
Highlighted IDENTICAL residue SER  215  index1  124  path  281  %Seq 100.00
Highlighted IDENTICAL residue ASN  219  index1  128  path  285  %Seq 100.00
Highlighted IDENTICAL residue TRP  220  index1  129  path  286  %Seq 100.00
Highlighted IDENTICAL residue GLU  223  index1  132  path  289  %Seq 100.00
Highlighted IDENTICAL residue LYS  226  index1  135  path  292  %Seq 100.00
Highlighted IDENTICAL residue TRP  227  index1  136  path  293  %Seq 100.00
Highlighted IDENTICAL residue GLY  239  index1  148  path  306  %Seq 100.00
Highlighted IDENTICAL residue SER  247  index1  156  path  313  %Seq 100.00
Highlighted IDENTICAL residue ASN  251  index1  160  path  317  %Seq 100.00
Highlighted IDENTICAL residue SER  254  index1  163  path  320  %Seq 100.00
Highlighted IDENTICAL residue GLY  257  index1  166  path  323  %Seq 100.00
Highlighted IDENTICAL residue PRO  261  index1  170  path  327  %Seq 100.00
Highlighted IDENTICAL residue LEU  265  index1  174  path  331  %Seq 100.00
Highlighted IDENTICAL residue TYR  269  index1  178  path  335  %Seq 100.00
Highlighted IDENTICAL residue PHE  272  index1  181  path  338  %Seq 100.00
Highlighted IDENTICAL residue HIS  275  index1  184  path  341  %Seq  50.00
Highlighted IDENTICAL residue ALA  276  index1  185  path  342  %Seq  50.00
Highlighted IDENTICAL residue GLU  277  index1  186  path  343  %Seq  50.00
Highlighted IDENTICAL residue VAL  278  index1  187  path  351  %Seq 100.00
Highlighted IDENTICAL residue LEU  279  index1  188  path  352  %Seq 100.00
Highlighted IDENTICAL residue VAL  287  index1  196  path  360  %Seq 100.00
Highlighted IDENTICAL residue ASP  290  index1  199  path  363  %Seq 100.00
Highlighted IDENTICAL residue GLU  291  index1  200  path  364  %Seq 100.00
Highlighted IDENTICAL residue HIS  293  index1  202  path  366  %Seq 100.00
Highlighted IDENTICAL residue LEU  295  index1  204  path  368  %Seq 100.00
Highlighted IDENTICAL residue LYS  296  index1  205  path  369  %Seq 100.00
Highlighted IDENTICAL residue LEU  306  index1  215  path  379  %Seq 100.00
Highlighted IDENTICAL residue SER  308  index1  217  path  381  %Seq 100.00
Highlighted IDENTICAL residue ASN  310  index1  219  path  385  %Seq 100.00
Highlighted IDENTICAL residue ALA  311  index1  220  path  386  %Seq 100.00
Highlighted IDENTICAL residue ARG  314  index1  223  path  389  %Seq 100.00
Highlighted IDENTICAL residue GLY  319  index1  228  path  394  %Seq 100.00
Highlighted IDENTICAL residue THR  320  index1  229  path  395  %Seq 100.00
Highlighted IDENTICAL residue PRO  321  index1  230  path  396  %Seq 100.00
Highlighted IDENTICAL residue GLN  323  index1  232  path  398  %Seq 100.00
Highlighted IDENTICAL residue ASN  324  index1  233  path  399  %Seq 100.00
Highlighted IDENTICAL residue ASP  325  index1  234  path  400  %Seq 100.00
Highlighted IDENTICAL residue LEU  326  index1  235  path  401  %Seq 100.00
Highlighted IDENTICAL residue GLU  328  index1  237  path  403  %Seq 100.00
Highlighted IDENTICAL residue SER  331  index1  240  path  406  %Seq 100.00
Highlighted IDENTICAL residue LEU  332  index1  241  path  407  %Seq 100.00
Highlighted IDENTICAL residue PHE  335  index1  244  path  410  %Seq 100.00
Highlighted IDENTICAL residue ILE  340  index1  249  path  415  %Seq 100.00
Highlighted IDENTICAL residue THR  343  index1  252  path  418  %Seq 100.00
Highlighted IDENTICAL residue LYS  349  index1  258  path  424  %Seq 100.00
Highlighted IDENTICAL residue ALA  369  index1  278  path  455  %Seq 100.00
Highlighted IDENTICAL residue GLN  376  index1  285  path  463  %Seq 100.00
Highlighted IDENTICAL residue GLU  377  index1  286  path  464  %Seq 100.00
Highlighted IDENTICAL residue LEU  386  index1  295  path  473  %Seq 100.00
Highlighted IDENTICAL residue ARG  389  index1  298  path  476  %Seq 100.00
Highlighted IDENTICAL residue THR  390  index1  299  path  477  %Seq 100.00
Highlighted IDENTICAL residue ILE  393  index1  302  path  480  %Seq 100.00
Highlighted IDENTICAL residue ILE  402  index1  311  path  489  %Seq 100.00
Highlighted IDENTICAL residue VAL  406  index1  315  path  493  %Seq 100.00
Highlighted IDENTICAL residue CYS  407  index1  316  path  494  %Seq 100.00
Highlighted IDENTICAL residue LEU  420  index1  329  path  507  %Seq  50.00
Highlighted IDENTICAL residue PHE  421  index1  330  path  508  %Seq  50.00
Highlighted IDENTICAL residue LEU  422  index1  331  path  509  %Seq  50.00
Highlighted IDENTICAL residue LYS  423  index1  332  path  510  %Seq  50.00
Highlighted IDENTICAL residue GLN  424  index1  333  path  512  %Seq  50.00
Highlighted IDENTICAL residue ALA  425  index1  334  path  513  %Seq  50.00
Highlighted IDENTICAL residue LYS  426  index1  335  path  514  %Seq  50.00
Highlighted IDENTICAL residue PRO  427  index1  336  path  515  %Seq  50.00
Highlighted IDENTICAL residue VAL  428  index1  337  path  516  %Seq  50.00
Highlighted IDENTICAL residue GLU  429  index1  338  path  517  %Seq  50.00
Highlighted IDENTICAL residue SER  430  index1  339  path  518  %Seq  50.00
Highlighted IDENTICAL residue LEU  431  index1  340  path  519  %Seq  50.00
Highlighted IDENTICAL residue THR  445  index1  354  path  533  %Seq 100.00
Highlighted IDENTICAL residue LYS  449  index1  358  path  537  %Seq 100.00
Highlighted IDENTICAL residue ASN  452  index1  361  path  540  %Seq 100.00
Highlighted IDENTICAL residue HIS  453  index1  362  path  541  %Seq 100.00
Highlighted IDENTICAL residue PRO  454  index1  363  path  542  %Seq 100.00
Highlighted IDENTICAL residue LEU  456  index1  365  path  544  %Seq 100.00
Highlighted IDENTICAL residue ILE  457  index1  366  path  545  %Seq 100.00
Highlighted IDENTICAL residue GLY  467  index1  376  path  554  %Seq  50.00
Highlighted IDENTICAL residue PHE  468  index1  377  path  555  %Seq  50.00
Highlighted IDENTICAL residue ASP  469  index1  378  path  556  %Seq  50.00
Highlighted IDENTICAL residue GLY  470  index1  379  path  557  %Seq  50.00
Highlighted IDENTICAL residue ALA  471  index1  380  path  558  %Seq  50.00
Highlighted IDENTICAL residue LEU  472  index1  381  path  559  %Seq  50.00
Highlighted IDENTICAL residue ASP  473  index1  382  path  560  %Seq  50.00
Highlighted IDENTICAL residue LEU  474  index1  383  path  561  %Seq  50.00
Highlighted IDENTICAL residue PHE  475  index1  384  path  562  %Seq  50.00
Highlighted IDENTICAL residue PRO  476  index1  385  path  563  %Seq  50.00
Highlighted IDENTICAL residue GLN  477  index1  386  path  569  %Seq  50.00
Highlighted IDENTICAL residue ASN  478  index1  387  path  570  %Seq  50.00
Highlighted IDENTICAL residue TYR  479  index1  388  path  571  %Seq  50.00
Highlighted IDENTICAL residue SER  480  index1  389  path  572  %Seq  50.00
Highlighted IDENTICAL residue THR  481  index1  390  path  573  %Seq  50.00
Highlighted IDENTICAL residue LYS  482  index1  391  path  574  %Seq  50.00
Highlighted IDENTICAL residue ALA  483  index1  392  path  575  %Seq  50.00
Highlighted IDENTICAL residue VAL  484  index1  393  path  576  %Seq  50.00
Highlighted IDENTICAL residue GLU  485  index1  394  path  577  %Seq  50.00
Highlighted IDENTICAL residue PRO  486  index1  395  path  578  %Seq  50.00
Highlighted IDENTICAL residue GLN  487  index1  396  path  579  %Seq  50.00
Highlighted IDENTICAL residue LEU  488  index1  397  path  580  %Seq  50.00
Highlighted IDENTICAL residue SER  489  index1  398  path  581  %Seq  50.00
Highlighted IDENTICAL residue GLY  490  index1  399  path  582  %Seq  50.00
Highlighted IDENTICAL residue VAL  510  index1  419  path  633  %Seq 100.00
Highlighted IDENTICAL residue SER  514  index1  423  path  637  %Seq 100.00
Highlighted IDENTICAL residue THR  517  index1  426  path  640  %Seq 100.00
Highlighted IDENTICAL residue LEU  520  index1  429  path  643  %Seq 100.00
Highlighted IDENTICAL residue ASP  521  index1  430  path  644  %Seq 100.00
Highlighted IDENTICAL residue GLU  524  index1  433  path  647  %Seq 100.00
Highlighted IDENTICAL residue TYR  534  index1  443  path  657  %Seq 100.00
Highlighted IDENTICAL residue ARG  536  index1  445  path  659  %Seq 100.00
Highlighted IDENTICAL residue LEU  537  index1  446  path  660  %Seq 100.00
Highlighted IDENTICAL residue ASP  538  index1  447  path  661  %Seq 100.00
Highlighted IDENTICAL residue GLY  539  index1  448  path  662  %Seq 100.00
Highlighted IDENTICAL residue ARG  546  index1  455  path  669  %Seq 100.00
Highlighted IDENTICAL residue ILE  549  index1  458  path  672  %Seq 100.00
Highlighted IDENTICAL residue VAL  550  index1  459  path  673  %Seq 100.00
Highlighted IDENTICAL residue PHE  553  index1  462  path  676  %Seq 100.00
Highlighted IDENTICAL residue ASN  554  index1  463  path  677  %Seq 100.00
Highlighted IDENTICAL residue ASN  555  index1  464  path  678  %Seq 100.00
Highlighted IDENTICAL residue SER  558  index1  467  path  681  %Seq 100.00
Highlighted IDENTICAL residue PHE  561  index1  470  path  684  %Seq 100.00
Highlighted IDENTICAL residue LEU  565  index1  474  path  688  %Seq 100.00
Highlighted IDENTICAL residue SER  566  index1  475  path  689  %Seq 100.00
Highlighted IDENTICAL residue ALA  569  index1  478  path  692  %Seq 100.00
Highlighted IDENTICAL residue GLY  570  index1  479  path  693  %Seq 100.00
Highlighted IDENTICAL residue GLY  571  index1  480  path  694  %Seq 100.00
Highlighted IDENTICAL residue GLY  573  index1  482  path  696  %Seq 100.00
Highlighted IDENTICAL residue LEU  574  index1  483  path  697  %Seq 100.00
Highlighted IDENTICAL residue ASN  575  index1  484  path  698  %Seq 100.00
Highlighted IDENTICAL residue LEU  576  index1  485  path  699  %Seq 100.00
Highlighted IDENTICAL residue GLY  578  index1  487  path  701  %Seq 100.00
Highlighted IDENTICAL residue ALA  579  index1  488  path  702  %Seq 100.00
Highlighted IDENTICAL residue ASP  586  index1  495  path  709  %Seq 100.00
Highlighted IDENTICAL residue ASP  588  index1  497  path  711  %Seq 100.00
Highlighted IDENTICAL residue ASN  590  index1  499  path  713  %Seq 100.00
Highlighted IDENTICAL residue PRO  591  index1  500  path  714  %Seq 100.00
Highlighted IDENTICAL residue ASP  594  index1  503  path  717  %Seq 100.00
Highlighted IDENTICAL residue GLN  596  index1  505  path  719  %Seq 100.00
Highlighted IDENTICAL residue ALA  597  index1  506  path  720  %Seq 100.00
Highlighted IDENTICAL residue ARG  600  index1  509  path  723  %Seq 100.00
Highlighted IDENTICAL residue ARG  603  index1  512  path  726  %Seq 100.00
Highlighted IDENTICAL residue GLY  605  index1  514  path  728  %Seq 100.00
Highlighted IDENTICAL residue GLN  606  index1  515  path  729  %Seq 100.00
Highlighted IDENTICAL residue LYS  608  index1  517  path  731  %Seq 100.00
Highlighted IDENTICAL residue ILE  612  index1  521  path  735  %Seq 100.00
Highlighted IDENTICAL residue ARG  614  index1  523  path  737  %Seq 100.00
Highlighted IDENTICAL residue LEU  615  index1  524  path  738  %Seq 100.00
Highlighted IDENTICAL residue THR  620  index1  529  path  743  %Seq 100.00
Highlighted IDENTICAL residue GLU  623  index1  532  path  746  %Seq 100.00
Highlighted IDENTICAL residue ILE  625  index1  534  path  748  %Seq 100.00
Highlighted IDENTICAL residue LYS  632  index1  541  path  755  %Seq 100.00
Highlighted IDENTICAL residue LEU  635  index1  544  path  758  %Seq 100.00
Highlighted IDENTICAL residue VAL  639  index1  548  path  762  %Seq 100.00
Highlighted IDENTICAL residue ASP  645  index1  554  path  768  %Seq  50.00
Highlighted IDENTICAL residue VAL  646  index1  555  path  769  %Seq  50.00
Highlighted IDENTICAL residue GLU  647  index1  556  path  770  %Seq  50.00
Highlighted 178 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g02090-1z3i_X.pir.txt.1Z3I.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g02090-1z3i_X.pir.txt PIR amino_acid 1Z3I.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.