FANDOM


>gi|15226870|ref|NP_178318.1|	   763 residues, 50 /line  CHR19/ETL1 (chromatin remodeling 19); ATP binding / DNA binding / helicase [Arabidopsis thaliana]
MKRDFDE----------------------ISEEEWSQHSFNASRVLKRPR----------
------------------------------------------------------------
-----------TP-----------------------KKTRAATNP---------------
---------TPSIESFAFR----RPSTAMT------------------------------
--------IESNSSDGDCVEIED----------------------L---------GDSDS
DVKIVNGEDLLL--------------------EDEEEVEETKV-----VMRAARVGRRFV
IEDEEASDDD----------------DDEAESSASEDEFGG----------------GGG
GSGGRRGEDEDV-VGKALQKCAKISA---DLRKELYGTSSGVTDRYSEVE---TSTVRI-
---------------------VT-----------------------------QNDIDDAC
-KAEDSDFQPILKPYQLVGVNFLLLLYKKGIEGAILADEMGLGKTIQAITYLTLLS----
-----RLN-------NDPGPHLVVCPASVLENWERELRKWCPSFTVLQYHGAARAAYSRE
LNSLSKAGKPPPFNVLLVCYSLFERHSEQQKDDRKVLKRWRWSCVLMDEAHALKDKNSYR
WKNLMSVARNANQRLMLTGTPLQNDLHELW----SLLEFMLPDIFTTENVDLKKLL----
---------------------------------NAEDTELITRMKSILGPFILRRLKSDV
MQQLVPKIQRVEYVLMERKQEDAYKEAIEEYRAASQARLVKLSSK---SLNS-LAKALP-
--------------------------------------------------KRQISNYFTQ
FRKIANHPLLIRRIYSDEDVIRIARKLHPIGAFGFECSLDRVIEEVKGFNDFRIHQLLFQ
YGVN--DTKGTLSDKHVMLSAKCRTLAELLPSMKKSGHRVLIFSQWTSMLDILEWTLDVI
GVTYRRLDGSTQVTDRQ------------TIVDTFNN-DKSIFACLLSTRAGGQGLNLTG
ADTVIIHDMDFNPQIDRQAEDRCHRIGQTKPVTIFRLVTKSTVDENIYEIAKRKLVLDAA
VLESG-VHVDDNG---------DTPEKTMGEI---------------------LASLLM-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------G
>gi|108876505|gb|EAT40730.1|	   814 residues, 50 /line  helicase [Aedes aegypti]
-----------------------------IFNRRSFPIISGDQKL---------------
---------ELV--PGRQRIQALVDIDSTADPAP---AP---------------------
---APAP-VLTVR-----------------------DKELCLQKVRAERPDV--------
------DTMLVQDTLVRHQWSVEKALEDLK------------------------------
--------SNCGPKGHRVEQRRSE---AGQSGEK----------------------TSHG
GSDSEDESGRQQ--------------------DRVFDSDDDSDDGGNY----GMSKDRKG
VFEFLNNGTANELTAVKTLSTKKVDLLIDLRPFTSWDELVD----------------KLK
SHK-SLQT----DILNHTQEYLSRRN---NLVTIMNKC--------KKIC----------
---------------------QKLESAI------------AA----DG-------G-LIE
-QPSNIPEGFKLAEYQLVGLNWLSVMHRNDMNG-ILADEMGLGKTIQVIAFLAWLK----
-----END-------LIKHPQLIVVPSSTLDNWDNELRKWCPELIIMKYYGSQEERKLIR
ID--WAKNGISDVDVVLTTYHMMG----ASGEEKKMWRVTPFQYVIFDEAHMLKNMTSQR
YENLLRI--RADRRILLTGTPLQNNLLELM----SLLCFVMPKLFGGKVEDIKALFQRI-
----------------------KTKDSGEDQ--TTFEKNQIERAKQIMKPFILRRLKKDV
LSFLPPKTEEIMKVPMLDSQKEKYMDLVSEYQNAT--GVFKSST----------------
--------------------------------------------------EISGMSIMMD
MRKLANHPLLLRYYFSDAEVRKIARKLAGDSDW-KNKNIDETFQDIAYLSDFKLLQLKEK
YT---SLYDLRIPDQLIVASGKFRQLDELLPKLKREGHRVLIFSQFVMMLDIMEKYLDIR
HYGFLRLDGQTAVTERQ------------EMIDLYNQ-DPNIFIFLLSTKAGGLGINLTA
ADTVIIHDIDFNPYNDKQAEDRSHRMGQTKPVTIYKLVSEGTIEEGMLMIAQEKLQLEKD
VTDEG-VDK--------KEEH-KCMVRLLTMA--LGMDEN--------------------
----------------------------------------KAETI-----------LKNE
SPKKNQQDED--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------F
>gi|119114206|ref|XP_319118.3|	   832 residues, 50 /line  ENSANGP00000022335 [Anopheles gambiae str. PEST]
---LLR-----------------------INMTHNMASFISDGKL---------------
---------SLI--PGRKRIQMMGDSDSESDAST---TPI--------------------
---KPSPAALTIK-----------------------EKELRLQMVRQACMDV--------
------DAMLLQSSLVSNEWDVDKAIEELK------------------------------
--------KTAVKRKIIVSPSPEK---NQQQAKKRR--------VQ---------EPNRS
DDESDVDSDRPA--------------------EQVFDSDEDSDGHGGSYSHGKLSNERKN
VLEFLNTAGLNEMICVKTLSMKKIELLLEQRPFKDWSNLVD----------------KLK
SHR-SLQT----DILNYTQEYLTRRK---NIAAMMSKC--------KKIT----------
---------------------KKLEEAI------------AS----GS-------GTLVE
-QPGNIADGFKLAEYQLVGLNWLTIMYRHKMNA-ILADEMGLGKTIQIIAFLAWLK----
-----ENN-------HQERPNLVVVPSSTMDNWEQELVKWCPELVILKYYGSQAERRMIR
VD--WAKNGINEVDVVLTTYHMMG----ASGEEKKMWRVTQFDYVVFDEAHMLKNVHSQR
YQNLIRI--NAKYRILLTGTPLQNNLLELM----SLLCFVMPKLIGSKVEDIKTLFQGK-
----------------------KTNKGEGEEELSSFEKNQIDRAKLIMKPFVLRRLKKDV
LAFLPPKKEVVLKTSMIDSQQEKYNEIVNEYQNAT--GKVKDYT----------------
--------------------------------------------------EISGMSIMMD
LRKLANHPLLLRYYYSDDDVRNIARKLATDPDY-KGTKEDDIFYDIAYLSDFKLYEMRDK
YT---TLYDLQLPEKLITSSGKFRQLDELLPKMKEEGHRVLIFSQFTMMLDIMERYLKIR
KHGFLRLDGSTAVTERQ------------ELIDQYTQ-DPDLFIFLLSTKAGGLGINLTA
ADTVIIHDIDFNPYNDKQAEDRAHRMGQKKPVTIYKLISEGTIEEGMLMIAQQKLQLEKD
VTEQDGKNP--------MDDH-KCMVGLLTMA--LGLDEK--------------------
----------------------------------------KAETI-----------LKNE
SPMKKPMQEE--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------F
>gi|110755099|ref|XP_396302.3|	   830 residues, 50 /line  PREDICTED: similar to CG5899-PA, isoform A [Apis mellifera]
MSDSNSP----------------------KTDASSSSLSGNLRQF---------------
---------RFQ--KKQLKPSNMSDDDSNLMGSE---IQF--------------------
----RRK-AVNII-----------------------EDSDSDAGSTKESNSL--------
------DSTE-KDIPNNINWNNEEGDEISR------------------------------
--------HNRKRTFKNSSRINKK----------KR--------RK---------LNTEE
DIDIDSDEASFK--------------------DKVFDSDEDSDIEIS----NELTADKKA
VLEFMQNALTSELLLMSQCSQKKANAIIEARPFENWIDIVQ----------------KFQ
NNK-YLDT----ELLNSAQELLATRH---AVEALMKKC--------LRLS----------
---------------------TNIERAV------------AA----GA-------SAITR
-QPKGLSPNLKLAPYQMVGLNWLAVMHAQNVNG-ILADEMGLGKTVQVIAFLTYLK----
-----ESGLK----GEKDGPHLIVVPSSTMENWNNELERWSPDLKVVQYYGTQEERKEMR
FG--WRNGDLDDVDVLLTTYNLIS----STPEERRLFRVMPLYYVVFDEAHMLKNMGTIR
YENLVRI--NAKHRILLTGTPLQNNLLELM----SLLIFVMPSLFAGKQADLKSLFSKN-
-----PKL--------------PSIKKNA--EQPLFEQEQVKNAKQIMRPFVLRRLKAEV
LRDLPEKKERMIKCPMIEKQQKMYTNLIAEFSAEA-----DQST----------------
--------------------------------------------------EVNGIGMMMQ
LRKLANHPLLVRDYYNKSKLKVISSRLAKEHSY-KQKNADYVFEDLQWMSDYQINQLTRT
YK---SIAGLGLPQELIPEAGKLKILDELLPKLKEEGHRVLIFSQFTMILDILEEYLTIR
GQTYLRLDGSTPVTDRQ------------CLINQYME-DENIFIFLLSTKAGGLGINLTA
ADTVIIHDIDFNPYNDKQAEDRCHRVGQKRSVSIIRLLSEDTIEEGMYEIAQDKLHLEQQ
ITGDE-ENE--------STDK-KSVLKLLKMT--LGLDHN--------------------
----------------------------------------KSLSL---------------
SPVKNARTSNGLLNGEENCNIE--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------F
>gi|111065216|gb|EAT86336.1|	   678 residues, 50 /line  hypothetical protein SNOG_06505 [Phaeosphaeria nodorum SN15]
------------------------------------------------------------
-------------------MARKSNVDSDGPS-----TAD--------------------
---ASANEDVEMQ-----------------------DQDTKISGFKKFGSQYYQ------
------DTPDYTDSDTNPNTTASSVAGDAP------------------------------
--------VDGRKKR--AEALNMR---KSIYGKK----------------------HDRL
GASKEDDTIRRF--------------------RYLLGLTDLFRHFID----TNPNPHIKE
ILAEIDRQDEEEVKKTKASKVRKGGAAAERRRKTEQEEDAE----------------L--
------------------------------------------------------------
---------------------VREEKHG------------HN----ET-------I-FRE
-SPGFI-NG-VMRDYQVMGLNWLISLHENGISG-ILADEMGLGKTLQTISFLGYLR----
-----FIA-------GITGPHLVVVPKSTLDNWKREFERWIPEINVLVLQGNKDDRAELI
KE----RLVDEKFDVCITSYEMIL-------REKTHLKKFAWEYIIIDEAHRIKNEESSL
AQMVRLF--NSRNRLLITGTPLQNNLHELW----ALLNFLLPDVFGDS-AAFDEWFSQQ-
----------------------DT-----------DSDTVVQQLHKVLRPFLLRRVKADV
EKSLLPKKEINLYVGLSDMQVDWYKKILEKDIDAVNGGAGNKES----------------
--------------------------------------------------KTRLLNIVMQ
LRKCCNHPYLFE--------------------------------GAEPGPP---------
---------YTTDEHLVNNAAKMVMLDRLLKRMKAQGSRVLIFSQMSRVLDIMEDYSVMR
GYQYCRIDGSTAHEDRI------------AAIDDYNKPDSEKFLFLLTTRAGGLGINLTT
ADIVVLFDSDWNPQADLQAMDRAHRIGQTKQVYVFRFVTEGAIEEKVLERAAQKLRLDQL
VIQQG-RSQ----QP--AKGA-ASKDELLTMI--QHGAEKG-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------L
>gi|149248292|ref|XP_001528533.1|	   917 residues, 50 /line  chromatin remodelling complex ATPase chain ISW1 [Lodderomyces elongisporus NRRL YB-4239]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------MKVEKLG------------GA----QT-------FEFSE
-SPGYV-HG-KLRPYQVQGLNWLVSLYENNLSG-ILADEMGLGKTLQSISFLGYLR----
-----FMH-------GINGPHLVIAPKSTLDNWHREFNRWIPEINAVVLQGDKEERSELI
KN----RIMTCDFDVIIASYEIVI-------REKSTFKKFNWEYIVIDEAHRIKNEESLL
SQIIRMF--HSKNRLLITGTPLQNNLRELW----ALLNFILPDVFADN-ESFDEWFQNN-
----------------------DNSE---------EDQEVILQLHKVLKPFLLRRIKADV
EKSLLPKKEINVYTKMTPMQRNLYQKILEKDIDAVNG-ANKKES----------------
--------------------------------------------------KTRLLNIVMQ
LRKCCNHPYLFD--------------------------------GVEPGPP---------
---------FTTDEHLVFNAQKMIILDKLLKKFKAEGSRVLIFSQMSRMLDILEDYCYFR
EYQYCRIDGQTEHVDRI------------NAIDEYNKPGSEKFVFLLTTRAGGLGINLTS
ADIVILFDSDWNPQADLQAMDRAHRIGQTKQVKVFRFITENAIEEKVLERAAQKLRLDQL
VIQQG-RNTAGLDGQ--QSSKAASKNELLDMI--QHGAADVFK-KDDDGQDVDIEEILKR
SEEKTQELNEKYSKLNLNALQNFSND--ESVYEWNGENFKKKEPA--TI---TNIGHAWI
NPGKRERKENYSINLYYKDVLNTGGRTQPTVNKSGPRPPKQLNLYDHQFY-PPKLLELYE
LEKNYYKKQTQYKAPLRAGDASTLKERELEQRLEQEEIDNSLPLTEEERQLKAELMDQGF
GNWNRKDFYHFISVCSKYGRNSIPMIAKEFPEKTEEEVREYAKAFWKNYKEIDGYEKYIG
QIELGEEKIIKSRLQKEALRRKLSQYKYPLLELKLKFPPSSSTKRVYSEEEDRFLLVQLY
RFGVDLPNIYERIKEAIRDSPFFQFDFFLQSRSAQEIGRRCVTLLGCVTKEINPELHVKV
PNGGGSTSAKGGTGGATKRKESTPIDGKAKRLKK
>gi|114631901|ref|XP_507937.2|	   700 residues, 50 /line  PREDICTED: helicase, lymphoid-specific isoform 16 [Pan troglodytes]
MQVKRSQ-----------------------------------EIL---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------SVAKKNRKENEDENSS------------------------------
STN-LCVE----DLQKNKDSNSIIKD---RLSETVRQN--------TKFF----------
---------------------FDPVRKC------------NG----QP--------VPFQ
-QPKHFTGG-VMRWYQVEGMEWLRMLWENGING-ILADEMGLGKTVQCIATIALMI----
-----Q-R-------GVPGPFLVCGPLSTLPNWMAEFKRFTPDIPTMLYHGTQEERQKLV
RNIYKRKGTLQIHPVVITSFEIAM-------RDRNALQHCYWKYLIVDEGHRIKNMKCRL
IRELKRF--NADNKLLLTGTPLQNNLSELW----SLLNFLLPDVFDDL-KSFESWFDIT-
----------------------SLSETAEDIIAKEREQNVLHMLHQILTPFLLRRLKSDV
ALEVPPKREVVVYAPLSKKQEIFYTAIVNRTIANMFG-SNEKET--IELSPT-GRPKRR-
-TRKSINYSKID-DFPNELEKLISQIQPEVDRERA---VVEVNIPVESEVNLKLQNIMML
LRKCCNHPYLIEY-------------------------------PIDP------------
-----VTQEFKIDEELVTNSGKFLILDRMLPELKKRGHKVLLFSQMTSMLDILMDYCHLR
DFNFSRLDGSMSYSERE------------KNMHSFNT-DPEVFIFLVSTRAGGLGINLTA
ADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQKIVERAAAKRKLEKL
IIHKN-HFKGGQSGLNLSKNFL-DPKELMELLKSRDYEREIKGSREKVISDKDLELLLDR
SDL---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---IDQMNASGPIKE--------KMGIFKILENSEDSSPECLF-----------------
----------------------------------
>gi|115313218|gb|AAI24095.1|	   769 residues, 50 /line  Unknown (protein for IMAGE:2640737) [Danio rerio]
MSGIVKE-----------------------------------ETR---------------
---------SIS--PHCPKPNESEEPEGTTIEET---TMEKSKHEEMVITKEMEE-----
---EEKNLEEEGE-----------------------KKEREMMEEARQSRGNDS------
------QEMRFK-RLQHLLEKSNIYSKFLL------------------------------
--------TKMEQQQQEEKLKKER---LEKKAAVLK-----------------------Q
KGSDKKTVKVER--------------------KKRGRED---------------------
-YKIADVMTKEEIMSKAKKPKME--EEAQA------------------------------
SVK-LEAE----DIEKLSDTNSDIKG---RLSETLREN--------SKQM----------
---------------------LDPERTV------------NG----QP--------VPAQ
-QPQLFTGG-VMRWYQVEGIEWLRMLWENGING-ILADEMGLGKTIQCIAHIAMMV----
-----E-K-------KVLGPFLVVAPLSTLPNWISEFKRFTPEVSVLLYHGPQKERLDLV
KKIRQHQGSLRMCPVVVTSFEIAM-------RDRKFLQRFHWNYLIVDEGHRIKNLNCRL
VQELKML--PTDSKLLLTGTPLQNNLSELW----SLLNFLLPDVFDDL-KSFESWFDIS-
----------------------TITSDAENIVANEREQNILHMLHQILTPFLLRRLKSDV
TLEVPPKKEIVVYAPLTNKQEAFYMAIVNKTIAKLLG-QEKDESAPAPLTPS-GRPKRR-
-SRKVVNYTEPNTDSMKDLEKYLEKVQQELDSQASSTPVVNVFMPVDAQVNLKLQNILML
LKRCCNHAYLIEY-------------------------------PLDP------------
-----TTGDFKIDEQLVEASGKFLILDRMLPELKKRGHKVLIFSQMTSILDILMDYCYLR
GYEYSRLDGSMSYADRD------------ENMKKFSS-DPEVFLFLLSTRAGGLGINLTS
ADTVIIFGSDWNPQADLQAQDRCHRIGQTKPVVVYRLITANTIDEKILERASAKRKLEKM
VIHKK-KKK---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|50414862|gb|AAH77794.1|	   756 residues, 50 /line  HELLS protein [Xenopus laevis]
-MPVGQS-----------------------------------SAE---------------
---------QVS--P-APKME--------------------PSDDDPIITESMIK-----
---EEEKLEKAAE-----------------------VEERKMIEKARMSWERDS------
------NEMRYK-RLQHLLEKSNIYSKFLL------------------------------
--------TKMEQQQLEEMRRKEK---LEKKQKRVQ--------PV---------KMQNQ
SSANEDQTGGRK--------------------KRQREEN---------------------
-YNISDVMSKEEILSVSKKSKLEHEDENY-------------------------------
SNK-LTSE----EIEKNGDSNSTIKD---RLSQTVRNN--------AKQL----------
---------------------LDPERKV------------NG----QP--------VPFQ
-QPKYFTGG-VMRWYQIEGMEWLRMLWENGING-ILADEMGLGKTVQCIATISMMV----
-----E-R-------GVPGPFFVCGPLSTLPNWVSEFKRFSPEIPVLLYHGNAQDRRRLA
RKINKREGSLQLFPVVITSFEIAM-------RDRPVLQHNAWKYMILDEGHRIKNMNCRL
IQELKLF--RSDNKLLLTGTPLQNNLSELW----SLLNFLLPDVFDDL-RSFESWFDIS-
----------------------GISQNAADIVANEREQNILHMLHQILTPFLLRRLKCDV
TLEVPPKREVIVYAPLTKKQETFYTAIVNKTIEKMLG-QEKDCEEILSSPAV-GRAKRR-
-SRRAVNYSELDKDTPNDLEKLINQLIKQQEVE-KERPSTKVHLPSDSQVNLKMRNIMML
LRKCCNHPYLIEY-------------------------------PLDP------------
-----LTQNFKIDEELVNSSGKFLLLDRLLPEMKKRGHKVLIFSQMTMMLDILMDYCYYK
KFNFCRLDGSMSYTDRE------------ENMRSFNT-DPDVFIFLVSTRAGGLGINLTA
ADTVIIYDSDWNPQADLQAQDRCHRIGQTRPVVVYRLVTANTIDQKIVERAAAKRKLEKL
VIHKK-KKK---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|116057711|emb|CAL53914.1|	   869 residues, 50 /line  putative helicase (ISS) [Ostreococcus tauri]
MSDVFEE----------------------FRHVNGELRKVEDGDVGARGD-----LSANA
---------SLS--PPWMRAGSKPKAGGKRKRRG---DADADDDDGFVVSDDDGDDEE--
--EIDEENEMSVA-----------------------SESSLGSASDEEVDGFGM------
--------SAGYERQSGYNPVVAGFRAPAR------------------------------
--------NSGGGSKAVAT--TSK---LTFNMKRPSTSA---AQQQ---------QQQAS
DDEASLSGSTTD--------------------DESVSASESEDIDLGS----KARSETKA
KLDALAAQAREARAAPSYRQ---REDYVAQREEDEFDEYRP----------------DAE
DWK-SAGEQGDADDDRAYEECKNMSK---RLRNTLKEA--------QNAA---NGKLPV-
---------------------FSVDNVV----------------------------EATG
-GRESGTFAVNLKPYQMVGVNFLMLLQQNGIPGAILADEMGLGKTAQAIAFIATSRYHPN
AGVHAEKGVRWPRVETKANPVLVVSPASLLENWKRELGMWAPNLRVGVFHGETRVEVRQT
EEFHRQHTGECCFDVIIVCYSLFERDSIESQDNRSWLQGMEFSHLILDEAHLLKNRDAQR
TIRLTRTARKAHYRLLLTGTPLQNNLRELE----ALIEFVLPGLLKDGE--LGDGI----
--------------------------------DDEQAERRVTKVRRILEPFVLRRLKETV
ATQLAPKTQVKEVIKMHDTQAEAYKIAVERIRREALE--------GKGSNGT-GTGLT--
--------------------------------------------------QSRLKAIFVH
LRKVANHPLLVRSKYTDEDLVEIAEQCHQRRIFGPDARLERVKTHVDSLSDFGLHQLCGD
FMLQGALREKLLSPECGLESAKVQRLRELLVELKAKGSRALIFSQWKIMLDILEWVLCHV
GFSYARLDGDTAVEERQ------------ELVDKFNAKDSSLDTFLLSTRAGGQGLNLTG
ADTVILHDCDFNPQIDRQAEDRCHRLGQEKQVTVYRFVTEGTVDEKIVAIAEHKMNLGST
ILAEG-EQA--------KPDS-KEETRAMQRI---------------------IEELVHG
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------S
>gi|145346994|ref|XP_001417965.1|	   609 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------MSK---RLRNTLKEA--------AHAE---NGRLPV-
---------------------FSVDNVV----------------------------EATG
-GMDSGTFSVNLKPYQMVGVNFLMLLQQNAIPGAILADEMGLGKTAQAIAFIATSRYHPD
TGALAENGVRWPRVVSKPNPVLVVSPASLLENWKRELGMWAPNMRVGVFHGESRADVRQT
EEYHRERTGECCYDVIIVCYSLFERDSIESQDNRSWLQRMEFSHLILDEAHLLKNRDAQR
TIRLTRTARKAHYRLLLTGTPLQNNLRELE----ALIEFVLPGLLKHGE--LGEGL----
-------------------------------EEDDQSERRVKKVRRILEPFVLRRLKETV
AKQLAPKVQVKDVIAMSGRQAEAYKLAVDRIRREALE--------GKARSAN-GIGLA--
--------------------------------------------------QSRLKAIFVH
LRKVANHPLLVRNEYTDEDLIEIADICHKKRVFGPDARLERVKEHVSGLSDFGLHQLCGD
YMLDGALKDKMLDPEIGLQSAKVQRLQELLVELKAKGSRPLIFSQWKIMLDILEWVLHHM
GWKYARLDGDTAVDNRQ------------ELVDRFNAKDSYLDTFILSTRAGGQGLNLTG
ADTVILHDCDFNPQIDRQAEDRCHRLGQTKTVTVYRLVTEGSVDEKIVAIAEQKLNLGST
ILAEG-DQA--------KPDA-KDETRAMQAI---------------------IEELVAS
G-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------D
>gi|119632238|gb|EAX11833.1|	   946 residues, 50 /line  SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1, isoform CRA_a [Homo sapiens]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------MDPEYEE----KMKADRAK
RFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLGR--PRIKK----------------DEK
QSL-ISAGDY-------------------RHRRTEQEE--------DEEL----------
---------------------LSESRKT------------SN----VC--------IRFE
VSPSYVKGG-PLRDYQIRGLNWLISLYENGVNG-ILADEMGLGKTLQTIALLGYLK----
-----HYR-------NIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDARAAFI
RD----EMMPGEWDVCVTSYEMVI-------KEKSVFKKFHWRYLVIDEAHRIKNEKSKL
SEIVREF--KSTNRLLLTGTPLQNNLHELW----ALLNFLLPDVFNSA-DDFDSWFDTK-
----------------------NCL----------GDQKLVERLHAVLKPFLLRRIKTDV
EKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNS--SGKMD----------------
--------------------------------------------------KMRLLNILMQ
LRKCCNHPYLFD--------------------------------GAEPGPP---------
---------YTTDEHIVSNSGKMVVLDKLLAKLKEQGSRVLIFSQMTRLLDILEDYCMWR
GYEYCRLDGQTPHEERE------------EAIEAFNAPNSSKFIFMLSTRAGGLGINLAS
ADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSI
VIQQG-RLIDQQS------NKL-AKEEMLQMI--RHGATHVFASKESELTDEDITTILER
GEKKTAEMNERLQKMGESSLRNFRMDIEQSLYKFEGEDYREKQKL--GM---VE----WI
EPPKRERKANYAVDAYFREALRV---SEPKIPKA-PRPPKQPNVQDFQFF-PPRLFELLE
KEILYYRKTIGYKVPRN----PDIPNPALAQREEQKKIDGAEPLTPEETEEKEKLLTQGF
TNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQDIEKIMA
QIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSK--GKNYTEEEDRFLICMLH
KMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEER--
-------------------------------ERA
>gi|123123061|emb|CAM19309.1|	   768 residues, 50 /line  SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Mus musculus]
MEPDT----------------------------------------ATEAA-----TVAVS
---------DAR--ATVVVV-EDEQPGPSTFKEE---GAAAAATEGTTATEKGEKKEK--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--ITSPFQLKLA--------------------AKASKSEKEMDPEYEE----KMKADRAK
RFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLAR--PRVKK----------------DDK
QSL-ISVGDY-------------------RHRRTEQEE--------DEEL----------
---------------------LSESRKT------------SN----VC--------VRFE
VSPSYVKGG-PLRDYQIRGLNWLISLYENGVNG-ILADEMGLGKTLQTIALLGYLK----
-----HYR-------NIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFI
RD----EMMPGEWDVCVTSYEMVI-------KEKSVFKKFHWRYLVIDEAHRIKNEKSKL
SEIVREF--KSTNRLLLTGTPLQNNLHELW----ALLNFLLPDVFNSA-DDFDSWFDTK-
----------------------NCL----------GDQKLVERLHAVLKPFLLRRIKTDV
EKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNS--SGKMD----------------
--------------------------------------------------KMRLLNILMQ
LRKCCNHPYLFD--------------------------------GAEPGPP---------
---------YTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWR
GYEYSRLDGQTPHEEREDKFLEVELLGQREAIDAFNAPNSSKFIFMLSTRAGGLGINLAS
ADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSI
VIQQG-RLIDQQS------NKL-AKEEMLQMI--RHGATHVFACKESELTDEDIVTILER
GEKKTAEMNERMQKMGESSLRNFRMDLEQSLYKFEGEDYREKQKL--GT---VE----WI
EPPKRERKANYAVDAYFREALRV-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|125549369|gb|EAY95191.1|	   835 residues, 50 /line  hypothetical protein OsI_016424 [Oryza sativa (indica cultivar-group)]
MRRGYEE----------------------IDDDEWSNHSFKPSRVLKRPS-----RGAQP
---------DSQ--PP----PPIDSFRYNPRPSS---SSAAAAATATVVLSDDDDDFE--
--LGEEERLRRAG-----------------------KSTRVLNRPQRQHSPPGR------
--------ALPPRESFRYNPKPAKAAAAVS------------------------------
--------VSDDDDDGFDLEDDDF-DIPSSRTSRPRRTA---GRRL---------ATAVA
DLSEEDDDLELA--------------------DDDFDHPDPRP-----TRPRRATARRFV
IKDDDDSDGDVGASEVDGVEAE-EDDGVNWSELENEDDEDG----------------DYG
ETK-VEVEEGDV-VGKALRKCARISA---DLRQELYGSSTRNCESYAEID---DSSVRI-
---------------------VTQVWSF------------DS----MD-VSEQDDVDAAC
-TSEESEFEPILKPYQLVGVNFLLLLHRKNIGGAILADEMGLGKTVQAVTYLTLLR----
-----HLY-------NDPGPHLIVCPASVLENWERELKKWCPSFSIIMFHGAGRTAYSKE
LSSLGKAGYPPPFNVLLVCYSLFERRSAQQKDDRKALKRWRWSCVLMDEAHVLKDKGSFR
WRNLMAVAQHARQRLMLTGTPLQNDLHELW----SLLEFMMPDIFATGDIDLKKLL----
---------------------------------NAEDHELISRIKSILGPFILRRLKSDV
MQQLVPKIQHVNFVTMDSEQFQAYNYAIDEYRGACQARSAKSTSN---FSNN-VVGLIP-
--------------------------------------------------KRQISNYFMQ
FRKIANHPLLIRRIYSDKDVDRIAKLLYPKGAFGFECSLERATQELRKYNDFAIHQLLVS
YGDS--GTKGALTDEHVLGSAKCQALAELLPSLANDGHRVLIFSQWTTMLDILEWTLEVI
GVTYRRLDGGWIGKLKI------------AAI-------------ALDNRNLSLSID---
CEHITIFIST-------------------------WLVTKGSVDENIYEIARRKLVLDAA
ILQSG-AELEDST---------DVPEKTMGEI---------------------LASLLL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------V
>gi|38344264|emb|CAE02069.2|	   863 residues, 50 /line  OSJNBa0005N02.1 [Oryza sativa (japonica cultivar-group)]
MRRGYEE----------------------IDDDEWSNHSFKPSRVLKRPS-----RGAQP
---------DSQ--PP----PPIDSFRYNPRPSS---SSAAAAATATVVLSDDDDDFE--
--LGEEERLRRAG-----------------------KSTRVLNRPQRQHSPPGR------
--------ALPPRESFRYNPKPAKAAAAVS------------------------------
--------VSDDDDDGFDLEDDDF-DIPSSRTSRPRRTA---GRRL---------ATAVA
DLSEEDDDLELA--------------------DDDFDHPDPRP-----TRPRRATARRFV
IKDDDDSDGDVGASEVDGVEAE-EDDGVNWSELENEDDEDG----------------DYG
ETK-VEVEEGDV-VGKALRKCARISA---DLRQELYGSSTRNCESYAEID---DSSVRI-
---------------------VT-----------------------------QDDVDAAC
-TSEESEFEPILKPYQLVGVNFLLLLHRKNIGGAILADEMGLGKTVQAVTYLTLLR----
-----HLY-------NDPGPHLIVCPASVLENWERELKKWCPSFSIIMFHGAGRTAYSKE
LSSLGKAGYPPPFNVLLVCYSLFERRSAQQKDDRKALKRWRWSCVLMDEAHVLKDKGSFR
WRNLMAVAQHARQRLMLTGTPLQNDLHELW----SLLEFMMPDIFATGDIDLKKLL----
---------------------------------NAEDHELISRIKSILGPFILRRLKSDV
MQQLVPKIQHVNFVTMDSEQFQAYNYAIDEYRGACQARSAKSTSN---FSNN-VVGLIP-
--------------------------------------------------KRQISNYFMQ
FRKIANHPLLIRRIYSDKDVDRIAKLLYPKGAFGFECSLERATQELRKYNDFAIHQLLVS
YGDS--GTKGALTDEHVLGSAKCQALAELLPSLANDGHRVLIFSQWTTMLDILEWTLEVI
GVTYRRLDGGTPVTERQ------------TIVDTFNN-DRSIFACLLSTRAGGQGLNLIG
ADTVIIHDMDFNPQMDRQAEDRCHRIGQQKPVTIYRLVTKGSVDENIYEIARRKLVLDAA
ILQSG-AELEDST---------DVPEKTMGEI---------------------LASLLL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------V
>gi|125985153|ref|XP_001356340.1|	   855 residues, 50 /line  GA19213-PA [Drosophila pseudoobscura]
-SDSSS------------PTKSSLSDLRQFRINKNTAVSSGQAKT---------------
---------ERV--PGKKRIQVMADSDSDGADSH---VT---------------------
---KKTKLELTVK-----------------------EKEERYMAAAKISPQY--------
------DTMAVQESLSRSNWDVAASIRYLR------------------------------
--------EHCKPKGQNGPLVKPK---LQPSS-----H-----SSR---------AYSDG
ECSDDEDVKQSK--------------------DQVYDSD-DSDSEMAT----KMTGQRKK
VFQFMNEATIVELQSVKTLSEKKATLIIEQRPFGDWAGLRK----------------KLE
SIR--MSG----DLLNYAQDLINKQN---TVATILNKC--------NNMV----------
---------------------SRLEKAI------------SN----GG-------G-IVD
-QPKMLTSGMQLADYQIIGLNWLTVMHKQEMNG-ILADEMGLGKTIQVIAFLAYLK----
-----EKG-------LSKAAHLIVVPSSTLDNWEAEIARWCPTLVVEKYHGSQDERRRMR
GR--YAKDGFTGFDVLLTTYHIVG----STPEERKMFRVCKLDYVIFDEAHMLKNMTTQR
YANLITI--NARMRILLTGTPLQNNLLELI----SLLCFVMPKFFAKSIEDIKSLFVKAR
PGRAFFHVHIELKRFLVSLLQKNKTDGD-QEEVSQFQETQIQRAKRIMKPFVLRRLKKDV
LKHLPKKQSFVEKVPMSSKQREYYHEVVDYYSNNK--GVVCSGG----------------
--------------------------------------------------DRAGITIMME
MRRCANHPLLMRHYFTDEHLRGFSKRLARATTY-KKTNEQYIFEELAIMSDFQVYQLCNK
HE----MTDVRIPDELICDSGKFEFLDTLLPKLKEEGHRVLLFSQFTMMLDIVEEYMRIR
KHGFCRLDGATAVKERQ------------DLITDFNV-DDNIFVFLLSTKAGGVGINLTA
ADTCIIHDIDFNPYNDKQAEDRCHRMGQQRPVTIYRLVAESTIEEGILMAAEEKLKLEKE
ITSTEK-GEGE------VHEQ-RCVVKLLTMA--LGLDKD--------------------
----------------------------------------QEEQL-------------SN
SLNNSLATPT--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------K
>gi|85724914|ref|NP_001033890.1|	   831 residues, 50 /line  CG5899-PC, isoform C [Drosophila melanogaster]
MLPLSSL----------VLRELVLAELKFQAID----TVANCLIS---------------
---------ERV--PGKKRIQVMADSDSDGNDSQ---TP---------------------
---KKTKLELTVK-----------------------EKEERYMAAAKISPHF--------
------DTMAIQESLSRTNWDVAASVRYLR------------------------------
--------ENCKPKGHNGPLAKSK---LKPRS-----NG---ISGG---------NFSDN
DHSDDDDVKQSK--------------------DQVYDSD-DSDSEMST----KMTGQRKK
VFQFMNEASLIELQSVKTLSEKKALAIIDVRPFSDWSDLRQ----------------KLE
SIR--MSG----DLLNYAQELINKQN---TVAAILSKC--------NNMV----------
---------------------SRLEKAI------------SN----GA-------G-IVE
-QPKLLSSGLQLADYQIIGLNWLTVMHKQEMNG-ILADEMGLGKTIQVIAFLAYLK----
-----ENG-------LSQAAHLIVVPSSTLDNWEAEISRWCPELVVEKYHGSQDERRRMR
GR--FAKDGFTGFDVLLTTYHIVG----STPEERKMFRVCKLDYVIFDEAHMLKNMTTQR
YANLITI--NARMRILLTGTPLQNNLLELI----SLLCFVMPKFFAKSIEDIKSLFAKK-
----------------------GKSDGD-QDEVSQFQETQIQRAKRIMKPFVLRRLKKDV
LKNLPKKLSLVEKVPMSSQQKIYYHELVDYYSNNK--GEVCSSS----------------
--------------------------------------------------ERAGIAIMME
MRRIANHPLLMRHYFTDANLRGFSKRLANASSF-KKTNEQYIFEELAVMSDFQVYQMMNK
HE----FYDVKIPDNLICDSGKFLYLDTLLPKLKAEGHRVLLFSQFTMMLDIVEEYLRIR
KFGFCRLDGATAVNVRQ------------DLITDFNG-DDSIFVFLLSTKAGGVGINLTA
ADTCVIHDIDFNPYNDKQAEDRCHRMGQQRPVTIYRLISESTIEEGILMAAEEKLKLEKD
ITSNEK-G--E------VHEQ-RCVVKLLTTA--LGLDKD--------------------
----------------------------------------QEEQL-------------NN
SLNNSIASPA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------K
>gi|145349184|ref|XP_001419020.1|	   956 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
------------------------MELERVREDQ--------------------------
------------------------------------------------------------
--------------------------------------NKKIAGDN--------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------KAG
KWKFLLAQTEVFAHFLS-----------GTKAANEAANKGK----------------RGR
N----------------------------KSHAAEESE---------------DAEL---
---------------------VEHAEDY------------QA-------------VRLT-
SQPTCIKFG-KMREYQIAGLNWMIRLFDHGING-ILADEMGLGKTLQTISLLGYLA----
-----EYR-------GVTGPHMVVVPKSTLGNWMNEFKRWCPMIRTFKFHGNAEEREAQK
AKFL----VPGGFDVCVTSYEMVI-------KEKTALKKFHWRYIIIDEAHRLKNENSRL
SIVLRTF--SANNRMLITGTPLQNNLHELW----ALLNFLLPEVFGNA-GQFDEWFANVE
-----------------------DGEGG--------SGAVVSQLHKVLRPFLLRRLKTEV
ETSLPPKKETILKIGMTEMQKTFYKRILQKDIDIVNSG----AD----------------
--------------------------------------------------RSRLLNIVMQ
LRKCCNHPYLFQG--------------------------------AEPGPP---------
---------YITGDHLIESSGKLALLDKLLPRLMQRGSRVLIFSQMTRLLDILEDYLMYR
NYQYCRIDGSTDGAVRE------------DHIDAFNKEGSEKFCFLLSTRAGGLGINLAT
ADTVIIYDSDWNPQMDLQAMDRAHRIGQKKEVQVFRFCTDGSVEEKVIEKAYKKLALDAL
VIQQG-RLQENKK--------NLGKDELLAMV--RFGAEKIFDSSTTSITDEDVDAIMAR
GEEETKALNSKMQGFTEKAIQ-FSMGAENSLYEFEDEDDKNVAALPEGIDMKTIISSNWI
DPPKRERKKNYNESDYYRSAMAQAA--RPSKPMG-PKIAKLQQMHDFQFYNTARIQEIYD
KDKD--KKKEEAKAA---------QDEEAPTEAEEDDPNAPPAITEEEKAEQESLLSQGF
TEWSRRDFQAFCRLSEKYGREDVESIASEMEGKTLKEVKDYAAVFWKRYEEIADHPRIIS
NIEKGEQKIQRQHDMLKAVREKIAKYKNPWRELKLTYGP--NKFKSFTEEEDRFLLCSIP
EVGFGN---WDELKAQIRQHWQFRFDWFIKSRTPKELGRRVETLISLIEKEAQDRGDKK-
----RDAEAEAEADGSAQKKVKVEAEGVTA----
>gi|18463957|gb|AAL73042.1|AF461813_1	   779 residues, 50 /line  chromatin complex subunit A101 [Zea mays]
MGTLSMSD------A--SPIPAKNWDASPVKLEAQGG-------------------DAIL
---------GMK--EEERLLELVKDEQADGILDSLPIDLEAKNGDASLITEAMKKEEE--
--Q----LEDTRI-----------------------------------------------
------------------------------------------------------------
-------------------------KVQEEEEARKREEA---ARLA---------FDPET
QYN---------------------------------------------------------
KLDELLTKTQLFSEFLLENMDRIADESVETQAEQPQVEEKK----------------KGR
GR-KRKAK----PQYNDKKAKTAVAAMLTRSREERLAEDSTL------------------
---------------------SEEERWE------------KE---------------QAN
LVP-LLTGG-KLKSYQIKGVKWLISLWQNGLNG-ILADQMGLGKTIQTIGFLAHLK----
-----G-K-------GMHGPYLIIAPLSTLSNWVNEISRFTPSLVSIIYHGGKAARAEIR
RKFMP-TNVGPDFPIVVTSYEMAM-------FDAKFLAAYKWKYVVVDEGHRLKNAKCLL
LKQLKRI--PMDNKLLLTGTPLQNNLAELW----SLLNFILPDIFSSH-QEFESWFDFS-
----------------------GGNEETDE----KKRLHVVSKLHAILRPFLLRRMKEDV
EQMLPRKKEIIIYANMTEQQKQIQHHLIEKTFDNYLH-EESD-------IIL-KRPGI--
--------------------------------------------------RARLHNLMIQ
LRKNCNHPDLLESP-------------------------------VDSTGL---------
---------YPPVEKLLEQCGKFQLFDRLLNFLMAQKHKVLVFSQWTKVLDIIEYYLDSK
GHAVCRIDGNVKLEERR------------RQIAEFNDVNSSMRIFLLSTRAGGLGINLTA
ADTCILYDSDWNPQMDLQAMDRCHRIGQTRPVHVYRLATSHSVEGRMIKRAFGKLKLEHV
VIGKG-QFEQDRA----KPSAL-DEGELLALL--KDEQTEEDRIVQTDISNEDLQRLMDR
SD-----------LMGPPPGAG-GANAASPLVP---------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------LKGPGWEVVV-------------------------
--------------------------------PAKSG-----------------------
-------------------------GGMLSSLTS
>gi|19114237|ref|NP_593325.1|	   944 residues, 50 /line  hypothetical protein SPAC20G8.08c [Schizosaccharomyces pombe 972h-]
MKRKDNKELICIPSS--SPPSTPIREENY------YLLTSSPIECSPIQQ-----LDLSG
SFKNYSTTSSRA--NGKKFGQLAMQSRIF---------FDTTDHKKYVESSYAAYDPH--
--DQPPERDVSLK-------ESSNKIN--PSNFFDSEQITKINAVKKRFPAL--------
------DSEMIIATLEKFNWRENITIHKLTFQKLLGRGN---------------------
-----STINKSAQKLNNQPIEKSSVDKENAKRKRYVEEG---TKQGQKKKPLRVIELSDE
ETNEDDLLGQSPTACTTDAN-IDNSIPENSDKIEEVSIESSGPSEVED----EMSEYDVR
VLNFLNESTLQEIVEVSGCESKVVEYFISKRPFPSLEKAEALCQRNAHAATGKR---KKS
DGR-NVGR----KLVNSTYEVLQGFD---AVDSLIAKC--------ERYGAMISNTMRSW
H---------------NLFDDKKMEQFL------------NT----STGSISYE--YNSQ
-QPSSIASGITLKSYQIVGLNWLCLMYKAKLSG-ILADEMGLGKTCQVISFLASLK----
-----EKG--------IQNRHLVVVPSSTLGNWLREFEKFCPSLRVESYSGTQSERINKR
YY--LMD---TDFDVLVTTYQLAS----GSRDDRSFLRKQRFDISIFDEGHYLKNRMSER
YKHLMNI--PANFRLLITGTPLQNNLKELI----SLLAFMLPKVFDNNMQGLDIIYKIK-
----------------------TTSDGD--IERAYLSQERISRAKTIMNPFILRRRKENV
LSDLPPKIQHVEYCHMEETQLSLYLSVLEL----------KNLV----------------
--------------------------------------------------NANRENILMQ
LRKAALHQLLFRSQYNLETLSLMSKRILREDAY-LDANPQYIFEDMEVMSDFELHKLADQ
YR---HLHPFALKGKPWMDSAKVKKLCSLLKK-SRPNERILIFSQFTQVLDILEYVLNTL
DLEFLRLDGSTPVETRQ------------QLIDDFHT-NENYKVFLLSTKSGGFGINLTC
ANIVILFDCSFNPFDDMQAEDRAHRVGQTRPVHVYRLITKNTIEENIRRLANTKLTLESS
LTTDSE-KI--------QKEISGELMKSLQMD--GRVD----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------TMDGSV--------------------V
>gi|19114529|ref|NP_593617.1|	   922 residues, 50 /line  hypothetical protein SPAC25A8.01c [Schizosaccharomyces pombe 972h-]
MDGKRKI-----------------------EHTADGTHYDATSNVKRKPI---FPPFIAD
SLSEATEKAN---------------------------VMGGGMNSRLQILSEMSKRVQAT
APISSLEHFKQLSDISPSFTSSANSI---------NQPYNYSGSLENLVPTPSA-GTPSQ
FMDAQNPYGAVYNALSQFSETEPKMPSYMDDEE--ASDS---------------------
-----LPLSLSSQSLSSQVTNQKPAPHRLTMRERYAANN---LTNGLQFT----------
------------LP-LSSRKTYEPEADDDSNDDMYSDDDSNADRWASR---IDTAALKEE
VLKYMNRCSTQDLADMTGCTLAEAEFMVAKRPFPDLESALVVKQPRPVIPKGRR---GRR
EKT-PLGP----RLVGICMEIMRGYF---VVDALIRQC--------EQLGGKIQRGIEAW
GL------------SNTATSDEGETSLVNFDQMKSFGTP-AN----SSF--------ITT
-PPASFSPDIKLQDYQIIGINWLYLLYELKLAG-ILADEMGLGKTCQTIAFFSLLM----
-----DK--------NINGPHLVIAPASTMENWLREFAKFCPKLKIELYYGSQVEREEIR
ER---INSNKDSYNVMLTTYRLAA----TSKADRLFLRNQKFNVCVYDEGHYLKNRASER
YRHLMSI--PADFRVLLTGTPLQNNLKELI----SLLAFILPHVFDYGLKSLDVIFTMK-
----------------------KSPESDF--ERALLSEQRVSRAKMMMAPFVLRRKKSQV
LDALPKKTRIIEFCEFSEEERRRYDDFASKQSVNSLLDENVMKTN---LDTNANLAKK--
--------------------------------------------------KSTAGFVLVQ
LRKLADHPMLFRIHYKDDILRQMAKAIMNEPQY-KKANELYIFEDMQYMSDIELHNLCCK
FP---SINSFQLKDEPWMDATKVRKLKKLLTNAVENGDRVVLFSQFTQVLDILQLVMKSL
NLKFLRFDGSTQVDFRQ------------DLIDQFYA-DESINVFLLSTKAGGFGINLAC
ANMVILYDVSFNPFDDLQAEDRAHRVGQKKEVTVYKFVVKDTIEEHIQRLANAKIALDAT
LSGNA-ETVEAED---------DDD-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|47217489|emb|CAG10869.1|	   861 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
----------------------------DETDDEDNGPSWEMQEVMVRKLQKKFPDQDKE
ELRMVLQEHDWNVEDALHVLQMFSDSDNTCVTSP--------------------------
-ETEEKKPKSASWEEQSGKDGKKKTSSKPHESVSESEEDGNNSDARKDGEDSDSGNQSHK
WLKTQSSTSTLLPWITKSSESASSLSSIRK------------------------------
-----STISSSAAQVLSRFTSGTSIAKKQAAESKRKARA---------------------
---------------SHQHLSSEEEDPEDTLSSEF----EDSDEELST--KGDMTDIKTE
IVTFFQTASVDEMSLISGCSVKKAQKVLELRPFDSWRSLIE----------------VFH
KDN-GLSE----DLLVGCKVVLRERK---VVLGLMSKC--------ESIS----------
---------------------SKMVKQV------------TMVME-RG-------TASMK
-QPHVLNSQFQLKPYQLIGLKWLLLLHEHKLSG-ILADEMGLGKTIQAIAFLSQLY----
-----QNG--------IEGPHLITVPSSTLDNWVRELKLWCPSLKVVVYYGSIEDRRYLR
HEIL---NEDIEYNVIVTTYNLAI----GNDSDRSLFRKLRLKYAVFDEGHMLKNMNSLR
YRHLMAI--NAEHRLLLTGTPLQNNLLELM----SLLNFIMPSMFSSSTSQLSKMFSMK-
----------------------S------HEEQSPFERDRISQAKLIMKPFILRRIKSDV
LKQLPAKEENIETCSMSEKQRALYQSLFMKLKRSTTG--E--------------------
--------------------------------------------------KRELCNVMMQ
LRKMANHPLLHRQYYTAEKLKAMSKLMLKEPSH-FDADAALIQEDMEVMSDFELHRLCQQ
YS---SISSYQLDTDLLLDSGKFILLKELLTSLKKKGDRVVLFSQFTMMLDIIEVLLKHL
SHRYIRLDGSTPIADRI------------VLIDEYNT-DSDIFVFLLSTRAGGLGINLTS
ANVVILHDIDCNPYNDKQAEDRCHRVGQTRTVRVIKLISKGTIDECILQLGQKKLKLEHD
MTAAEQGVE--------GTIP-EDMASLLKAS--LGL-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|8977885|emb|CAB95769.1|	   594 residues, 50 /line  hypothetical protein [Homo sapiens]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
KTN-GLSE----DLIWHCKTLIQERD---VVIRLMNKC--------EDIS----------
---------------------NKLTKQV------------TMLTGNGG-------GWNIE
-QPSILNQSLSLKPYQKVGLNWLALVHKHGLNG-ILADEMGLGKTIQAIAFLAYLY----
-----QEG--------NNGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIR
FNIH---SRYEDYNVIVTTYNCAI----SSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIR
YQHLMTI--NANNRLLLTGTPVQNNLLELM----SLLNFVMPHMFSSSTSEIRRMFSSK-
----------------------TKS----ADEQSIYEKERIAHAKQIIKPFILRRVKEEV
LKQLPPKKDRIELCAMSEKQEQLYLGLFNRLKKSINN--LEK------------------
--------------------------------------------------NTEMCNVMMQ
LRKMANHPLLHRQYYTAEKLKEMSQLMLKEPTH-CEANPDLIFEDMEVMTDFELHVLCKQ
YR---HINNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHH
QHRYLRLDGKTQISERI------------HLIDEFNT-DMDIFVFLLSTKAGGLGINLTS
ANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQD
MTTVDEGDE--------GSMP-ADIATLLKTS--MGL-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|50557192|ref|XP_506004.1|	   920 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
MKDQRV-QVPASPSQSQANAF-----------------------------SALFAPSDKN
SLSSFAYNP---------------------------------------------------
--------------SKPASNGQRPSAAT-PAAFTE-EQKQRLQRLKPMFNQL--------
------PLVKLREAVA-NSTDFDRAVAYLRRQGSIPSSSINSAPTHRKPASLVN----PL
AFLNPSVTTKPAPLSTKREVSKSKSIREKWKKEEPKAEDDLVVMEDKPSAPKRRLVQAKD
RAGYTPQPTRSPTP-LSPVS-ISRDTPMDIDEAEAD--ESDDFSEK----EDVDPGFDLR
VLEFLNTSSQRDLIDLSSCSQKVGELMVKNRPYKNLLQAQNVEFSDSESSSTEKKRGRGG
RKR-NAGE----RIVDAVSATLRGYE---AVDSLIQKC--------DVLGNQVAADIKSW
GV------------DIFGAKDGEGVDITDIDE--DVVKK-----------STVK--FLTE
-KPSILSDDLVLKDYQQVGINWLYLLYKKRLSC-ILADEMGLGKTCQVISFMALLK----
-----EQG-------EHEGPHLVVVPSSTLENWLREFQKFAPSLVVEPYYGSQNERAEMR
ETLS---DPENKYDVIVTTYNLAC----GTKFDVSFLKSIKFNCCVYDEGHMLKNSQTDR
YNKLMRL--KANFRLLLTGTPLQNNLRELV----SLLAFIIPSLFDGCKDDLAEIFKHK-
----------------------ATTNDAS-SHMPLLSQQRVNRAKTMMTPFILRRKKEQV
LKHLPPKTHEVAYCHLSPDQQAIYDEQMERMRQMRRDRA---------------AGKP--
--------------------------------------------------SSRVGNPLML
LRKAALHHLLFRRKFDDDTLKSMSKEIMKEERY-YDANRDYIREDMEVMSDFELNRLALQ
FP---SIEKYALEEEPWMDAAKVKKLAEMLPIMKENNDRVLIFSQFTQCLDILESVLNTL
GIAFLRLDGQTPVEARQ------------DMIDKYYE-ETDITVFLLSTKAGGFGINLAC
ANTVIIFDLSFNPHDDKQAEDRAHRVGQTRDVRVIRLVCKGTVEEKILELNNTKLALDKS
VSGEG-GEEEAKK----------NESKIEEML--MADD----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------E
>gi|91089209|ref|XP_967093.1|	   871 residues, 50 /line  PREDICTED: similar to CG5899-PA, isoform A [Tribolium castaneum]
MSENG------------SPT---LLNLRDFRIQKKTLS----------------------
HHSNNGAISSASNGAVRRRIIAFSDSDSDCDSSGTNSQSAV-------------------
------TPKPNIVIVPNSKNMKNP---------AVLEKENQMKYLMSSFPNV--------
------DAMVIHDVLSRHGFKVDEAASELARCHAVEFNSQGYAKWKEANTS-NN----PE
SLVKSTGK--RKPSPESAPYNKRK-----------------------------KFKRRKS
DDDTDDSTGSNQ----------------DFKDRRVFDSDEDSDVEISD----ELTGDKRK
VFEFMQTATESELQLMSFCSKKKAEAIIEARPFTGWVDLVQ----------------KLS
NNK-NLNT----DLLNAAQQVLMTRN---NIRHLMKKC--------TNLA----------
---------------------QQMEKAV------------AA----GAG--------VKA
-QPRILSVSLRLTNYQMVGLNWLAVLHAQRVNG-ILADEMGLGKTVQVIAFLAYLK----
-----ETF-------QAQNTHLVVVPSSTLDNWRSEFARWCPQLRVFMYYGSTEERRGFR
VD--FAKGILADFDVILTTYSLVG----NSPEERKMFRVTPMHYVIFDEAHMLKNMNTQR
YENLIRI--NAKHRILLTGTPLQNNLLELM----SLLIFVMPKMFAEKTEDLKSLFQKT-
----------------------SKSKQTD-DTLPPFEREQIEQAKRIMKPFVLRRLKCDV
LQDLPKKIDHVMKVPMAPTQKEQYEALVASYQNAA----VEEES----------------
--------------------------------------------------AYNGMSIMTD
LRKLSNHPLLLRYHYDEHQIREMAKLLVRDPTY-KDTVEEYIVQDLLFMSDFEINKLTKI
HR---CLERYMLPDNLILTSGKFLYLDKILAELKQNGHRVLIFSQYVIMLNVMEDYLKIR
KHKYLRMDGSTPVNERQ------------DLVDEYMG-DNSIFIFLLSTRAGGLGINLTS
ADTVIIHDIDFNPYNDKQAEDRCHRMGQTRPVTVYRLVSQGTIEEGMLEMNKEKLKLERQ
ITTEE--TD--------NPDV-KSVVRLLSSA--LGIDSS--------------------
----------------------------------------KANAF--------------V
SPPKKKT-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|58270542|ref|XP_572427.1|	   939 residues, 50 /line  chromosome organization and biogenesis -related protein [Cryptococcus neoformans var. neoformans JEC21]
MKDTLD------------KRTNARKDEK------YPSLNGSPSDVLRAIHRHS-------
------------PQPLRRPKPRYVDPDEEES--------PVKPTPATPSMISSVRQPS--
---------LVHAAQSARD----------------DQEEKMIQRLASQFPNV--------
------ERSTISSLLRKYPGNPDRAINQIHYANQMKAEQESYTSARSTTSKRSSPLPVPV
SPAASNSK-SKKKNENSTIYANRK--------------------------------RHRR
SNDSEEEFSGSE------------------SEDDFSDGDD---GRKRRKGEDDEPDAEGA
ALKAFNEDSVETLTGTIACRPEQAAIIIKHRPYEDVDDVRA----------------KLT
KAR-GVSF----KLFEQYTEIMEGFV---QIDACLNRC--------EAIASDVAKTLAVW
KGASHAQDGSVVGTPRSDGLNDVKVDVAKVSELLKNETDVKKRKILKQY--------IQT
-QPSTLSEGTVLKDYQLLGVNWLNLLYSKRIGC-ILADEMGLGKTIQVIAFIAALK----
-----ER--------GIIGPHLIFVPASTLENWTREFRRFAPDIDVQTYYGSQAERAGLR
SDLK-AQFRRGELEVVLASYTQMT----SADDLSFFRKKIDFETCVYDEGHRLKSCTTKA
YTDLLSI--KPKWRLLLTGTPLQNNLQELLSLCQSLLMFIHKDTFTDAEPYLRAIFKSQG
-------------------------------SASLLSHTRTTRARTMLTPFVLRRRKAQV
L-SLPPKIEIVEHCEMTKVQSKLYSETMQKSKKILSELTEEALEEVAGEDGSVATGKKPE
ADKKSVKGKKA------------------------------------SGVTTSGSNILMD
LRKAASHPLLFRRLYTDAKIRQIAKACLNTPSY-CDCNLDYVIEDLERLQ----------
----KELHKYALDPEVFLEGGKVMAMVKHIERCKAEGKRMLLFSQFVMILDILEGALNHL
GIRYTRLDGQTKTDERQ------------GLVDEFND-DTDITVFLLSTKAGGVGINLTA
ASVVVIYDQDFNPHNDRQAADRAYRIGQERKVEVIKLITKNSIDEDMLEIGLTKLQLDDM
VGGEE-ITLDGTDGAG--ADDK-TAKET-------------------------RKSLL--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------TQLRTKFVESE-------------------
------------------------------------------------------------
---------------------------------S

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.