FANDOM


&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g02080-2i13A.pir.txt

======================================================

Assigned types to 516 residues in Sequence 2-02080, 4 remain unknown
Assigned types to 183 residues in Sequence 2i13_A, 337 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 107  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 108  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 182  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 192  All residues are positively and negatively charged

Translated sequence file At2g02080-2i13A.pir.txt into sequence alignment.

======================================================

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

>2I13.pdb  Made from 4082 ATOM records in 2I13.pdb
FSRSDHLAEHQRTHKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPEC
GKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKP
YKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRT
HKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRH
QRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQL
AHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTRRDALNXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

======================================================

Best alignment:
2I13.pdb    93  RTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRD   142
                +T      + C  C K F RE NL  H+R H    P+K  +  KS ++  
2-02080     75  KTLMATNRFICDVCNKGFQREQNLQLHRRGH--NLPWKLKQ--KS-TKEV   119

2I13.pdb   143  ALNVHQRTHKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFS   192
                   V+          +  ++      + +H     GEK +KC +C K ++
2-02080    120  KRKVYLCPEPTCVHHDPSRALGDLTGIKKHYYRKHGEKKWKCEKCSKRYA   169

2I13.pdb   193  DKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQ   229
                 + D   H +T  G K Y+C +CG  FS+R +   H+
2-02080    170  VQSDWKAHSKT-CGTKEYRC-DCGTIFSRRDSYITHR   204

======================================================

Highlighted IDENTICAL residue THR  127  index1   94  path   76  %Seq 100.00
Highlighted IDENTICAL residue CYS  136  index1  103  path   85  %Seq 100.00
Highlighted IDENTICAL residue CYS  139  index1  106  path   88  %Seq 100.00
Highlighted IDENTICAL residue LYS  141  index1  108  path   90  %Seq 100.00
Highlighted IDENTICAL residue PHE  143  index1  110  path   92  %Seq 100.00
Highlighted IDENTICAL residue ASN  148  index1  115  path   97  %Seq 100.00
Highlighted IDENTICAL residue LEU  149  index1  116  path   98  %Seq 100.00
Highlighted IDENTICAL residue HIS  152  index1  119  path  101  %Seq 100.00
Highlighted IDENTICAL residue ARG  154  index1  121  path  103  %Seq 100.00
Highlighted IDENTICAL residue HIS  156  index1  123  path  105  %Seq 100.00
Highlighted IDENTICAL residue PRO  161  index1  128  path  110  %Seq 100.00
Highlighted IDENTICAL residue LYS  169  index1  136  path  116  %Seq  50.00
Highlighted IDENTICAL residue SER  170  index1  137  path  117  %Seq  50.00
Highlighted IDENTICAL residue SER  172  index1  139  path  118  %Seq  50.00
Highlighted IDENTICAL residue ARG  173  index1  140  path  119  %Seq  50.00
Highlighted IDENTICAL residue ARG  174  index1  141  path  120  %Seq  50.00
Highlighted IDENTICAL residue ASP  175  index1  142  path  121  %Seq  50.00
Highlighted IDENTICAL residue ALA  176  index1  143  path  122  %Seq  50.00
Highlighted IDENTICAL residue LEU  177  index1  144  path  123  %Seq  50.00
Highlighted IDENTICAL residue ASN  178  index1  145  path  124  %Seq  50.00
Highlighted IDENTICAL residue VAL  179  index1  146  path  125  %Seq  50.00
Highlighted IDENTICAL residue HIS  180  index1  147  path  126  %Seq  50.00
Highlighted IDENTICAL residue GLN  181  index1  148  path  127  %Seq  50.00
Highlighted IDENTICAL residue ARG  182  index1  149  path  128  %Seq  50.00
Highlighted IDENTICAL residue THR  183  index1  150  path  129  %Seq  50.00
Highlighted IDENTICAL residue HIS  184  index1  151  path  130  %Seq  50.00
Highlighted IDENTICAL residue LYS   20  index1  152  path  131  %Seq  50.00
Highlighted IDENTICAL residue PRO   21  index1  153  path  132  %Seq  50.00
Highlighted IDENTICAL residue TYR   22  index1  154  path  133  %Seq  50.00
Highlighted IDENTICAL residue ALA   23  index1  155  path  134  %Seq  50.00
Highlighted IDENTICAL residue CYS   24  index1  156  path  135  %Seq  50.00
Highlighted IDENTICAL residue PRO   25  index1  157  path  136  %Seq  50.00
Highlighted IDENTICAL residue GLU   26  index1  158  path  137  %Seq  50.00
Highlighted IDENTICAL residue SER   34  index1  166  path  145  %Seq 100.00
Highlighted IDENTICAL residue HIS   40  index1  172  path  151  %Seq 100.00
Highlighted IDENTICAL residue GLY   46  index1  178  path  157  %Seq 100.00
Highlighted IDENTICAL residue GLU   47  index1  179  path  158  %Seq 100.00
Highlighted IDENTICAL residue LYS   48  index1  180  path  159  %Seq 100.00
Highlighted IDENTICAL residue LYS   51  index1  183  path  162  %Seq 100.00
Highlighted IDENTICAL residue CYS   52  index1  184  path  163  %Seq 100.00
Highlighted IDENTICAL residue CYS   55  index1  187  path  166  %Seq 100.00
Highlighted IDENTICAL residue LYS   57  index1  189  path  168  %Seq 100.00
Highlighted IDENTICAL residue HIS   68  index1  200  path  179  %Seq 100.00
Highlighted IDENTICAL residue GLY   74  index1  206  path  185  %Seq 100.00
Highlighted IDENTICAL residue LYS   76  index1  208  path  187  %Seq 100.00
Highlighted IDENTICAL residue TYR   78  index1  210  path  189  %Seq 100.00
Highlighted IDENTICAL residue CYS   80  index1  212  path  191  %Seq 100.00
Highlighted IDENTICAL residue CYS   83  index1  215  path  194  %Seq 100.00
Highlighted IDENTICAL residue GLY   84  index1  216  path  195  %Seq 100.00
Highlighted IDENTICAL residue PHE   87  index1  219  path  198  %Seq 100.00
Highlighted IDENTICAL residue SER   88  index1  220  path  199  %Seq 100.00
Highlighted IDENTICAL residue GLN   89  index1  221  path  200  %Seq 100.00
Highlighted IDENTICAL residue ARG   90  index1  222  path  201  %Seq 100.00
Highlighted IDENTICAL residue ALA   91  index1  223  path  202  %Seq 100.00
Highlighted IDENTICAL residue HIS   96  index1  228  path  207  %Seq 100.00
Highlighted 55 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g02080-2i13A.pir.txt.2I13.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g02080-2i13A.pir.txt PIR amino_acid 2I13.pdb A 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.