Fandom

Proteins Wiki

At2g02080.1/MSA

< At2g02080.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|30677977|ref|NP_178317.2|	   516 residues, 50 /line  ATIDD4 (ARABIDOPSIS THALIANA INDETERMINATE(ID)-DOMAIN 4); transcription factor [Arabidopsis thaliana]
------------------------------------------------------------
---------------------------MSSSSYNTSVIPSSS------------------
------------SSAQ--------------------------------------------
-----------------------------------PF------------FITSSGTGDND
FNRK---D----------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------TFMSMIQ
Q------------------PNS-------SAPPPKKRRNQPGNPNPDAEVVALSP--KTL
MAT-NRFICDVCNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------REQNLQLHR-RGHNLPWKLKQKSTK---
-----------E-VKR--KVYLCPEPTCV---------HHDPSRALGDLTGIKKHYYRKH
----------------------------GEKKWKCEKCS--KRYAVQSDWKAHSKT-CGT
K----------------------------EYRC-DCGTIFSR--------------RDSY
ITHRAFCDA------LIQETARNPTVSFTSMTA-----ASSGVG----------SGGIYG
RLGGG---SALSHHHLS-DHPNFGFNPLVGYNLNIA---------------SSDNRRDFI
PQSSNP--NFLIQSASSQGMLN------------T----TPNNNNQSFMN-----Q-HGL
IQFDPVD---NINLKSSG--------------------TNNSFFNLGFFQ-ENTKNSETS
------------------------------------------------------------
------LPSLYSTDVL-VHHREENLNAGSN------------------------------
------VSATALLQKATQMGSVTSNDPS---------------------ALFRGLA----
-----------------------SSSNSS-----SVIANHFGGG--RIMEN---------
--DNNGNLQGL-MNSLAA-----------VNGGGGSG-GSIFDVQFG-------------
---------------D--NGNMSG----------------SDKLTLDFLG-VGGMV--RN
VNRGGGG-----------------------GGRGSARGGVSLD--------GEAKFP---
------EQNYPFG-R----------G
>gi|125526511|gb|EAY74625.1|	   600 residues, 50 /line  hypothetical protein OsI_002472 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
MAT-NRFVCEICGKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQLHR-RGHNLPWKLKQRGSK---
-----------EAVRK--KVYICPEASCV---------HHDPSRALGDLTGIKKHFFRKH
----------------------------GEKKWKCDKCS--KKYAVHSDWKAHSKI-CGT
R----------------------------EYKC-DCGTIFSR--------------RDSF
ITHRAFCDA------LTEESAKAIGGIPAAMA----------APGHHHHHHQLLFSPPPV
---------------------------MAHHQELAALQEQQQQQHHQDVMQSPHQHQQQL
VQQNCGSHNLFGEALAFLGLLHSCGRRHTLRLFLLVKLKLLADGVDESITTHNLTVLDPS
EDRIMKNRSLSQVN------------------------SNQNPLKL--------------
-------------------------------KDTNFVVKIKECIIVFYSSDKESCFNASS
SSLHLSLPKFIASMQQQQQEEEEGGGL---------------------------------
-FLVEEAAEAADQQQESSMSNLTSSASTVPPPPPPSSGNNGNNSNKRKRSLPGNPDPEAE
VVALSPATLMATNRFVCEICGKGFQRDQNLQLHRRGHNLPWKLKQRGSKEAVRKKVYICP
EASCVHHDPSR-----------------------------------ALGDLTGIKKHFFR
KHGEKKWKCDKCSKKYAV-HSDWKAHSKI-CGTREYKCDCGTIFSRSFFF----------
--------LPPPPSCLLPSIHGDRLQHLH----SYCLLLRYTCLGWLAVLLSHCHFASNP
VFSLPPALSVG-----TVTSRNRSSL
>gi|125804900|ref|XP_701006.2|	   506 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
MEVQVDVSCCKSVGTD-------------------------------------------L
SMLDIEDFISQICQLKKEVASLEAKLRER-------------------------------
--------------------------------------GEKLQPERQDSLCGVRA-QRSR
DTQNSELSLTLLCYTDAQDHQSS-------------------------------------
------------------------------------------------------------
-----------------------EPDAGEQQTTLK--------MCSVRLEDCRNLIQRTE
NTTEEDDQRDPEDDGDYDEDGKHDGENEDEDDNNAEDGKNYDDDEFI-------------
-------------------------------------PADDNIGSSDEEAPLPSK--DEL
KAK-KSFSCTSCGKAYTCQSYLLIHERKH-------------------------------
------------------------------------------------------------
------------------------------------------------SEPKVFICWRCR
KCFPTLQERKLHLKEHLAEKEFHCEQCGKNFLLSNQLKVHM-KTHSGDQRVQCDVCNK--
SFSTKGNLEA------HKRIHTGERP-----Y-----KCPHCEMSFNHKPHMKNHIRIHT
KERPYQCSECGKTFGNMTSLRSHLKIHSEEKPHQCKHCD--KRFRQKSALTSHEKTHSGE
KPYLCAECGMRFYIQAQMVYHQRIHTGEKPYLCNICGRSFNK--------------PGIL
INHMRTHT-GERPYK---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------CSHCDKTFARSDVLKTHERV
HTGEKPYRCSICEERFA-YLGSFQSHQ---------------------------------
-------KKHGGE-----------------------------------------------
------------------LVDAQISA
>gi|147859485|emb|CAN81435.1|	   527 residues, 50 /line  hypothetical protein [Vitis vinifera]
MDLKDRLSVDTWTQSSSSGNELPKDQQSFTNFSLQQQQHQHKWEDPSVLDYSVRIEPAFQ
EFNQTSATSSSL-------------------PCNPNSQIKNLNREDCQMNEMLE------
---PNRIQDWDPR-VMLSNLSFLEQKIHQLQD--LV-------HLIVGRRSQVLGR---T
NELVAQQQQLVTADLTSIIVQLITTAGTL----LPSVKNTLSTASPSVGQ----------
----LGQLGGVLFPSGTGMNGGGVAQSSGGS-----------------------------
--------------------------KVSDQSNQIDLTGACVIEQNN-------------
------------------------------------------------------------
--------------------ATEEHELKD----EDDADEGENLPPGSYEILQLEK--EEI
LAP-HTHFCMICGKGFK-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDANLRMHM-RGHGDEYKTPAALAKP--
NKESS-----SEPVLI--KRYSCPFAGCKR-N-----KDHKKFQPLKTILCVKNHYKRTH
----------------------------CDKSYTCSRCN-TKKFSVIADLKTHEKH-CGK
D----------------------------KWLC-SCGTTFSR--------------KDKL
FGHIALFQG-HTP-----AIPLDETKGSVGPSDRGEGNGAANK-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------VGSVGFNFS---------
-SNASSGSGVQDMMMDVKRGADEPTG----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------FFSPLTFDPCSLVGFH
------------------------------------------------------------
---------EFPRPPFEDSESSFSFLVPGSCSYTRKTG----------------------
----------------GESSSNDL-E
>gi|149047053|gb|EDL99773.1|	   586 residues, 50 /line  zinc finger protein 54 (predicted) [Rattus norvegicus]
------MADSSVNTSQCLL----------TFRDVAVDFSQEEWECLAS------------
---------------------------------PQRALYIDVMLENYSNLV-SV------
-----------------ENYCICDTVCQPVKTERESCQCNELGKMLHDPSHGGLY-----
---KRSDTTETSNNYRCCKDRDVSVDSSNP------------------------------
------------------------------------------------------------
----------------DQHKSTHTGEEPCTSE-----------DCEKSFDLCSNITQD--
---------------QTFYTEEK----EHRQEKHDDHFSSTYSLM---------------
-------------------------QQSIYIGANAGQCVKYGKCFSIASSLSIQQ--RID
TGN-KPYKCNICDKSFTQCSSLKTHRKTH-------------------------------
------------------------------------------------------------
------------------------------------------------Q-----------
-------------RLRAGTKPYKCSDCEKSFSYLSALKSHQ-KRHTGEKRYKCKECDK--
SYAYRTGLKR------HQKIHTAKER-----Y-----SCQHCGKVFHQLSHFKSHFTVHS
AEKPYKCNECHRSFPHYVFFRRHKKNHSLQKSHKCKECG--KSFFILSHLKTHYRIHTGE
KPYKCTECDKSFTQYSHLRRHQRIYTGKKLYRCEVCDKWFTM--------------SSSL
SRHQKIHT-EAKTYK-----CKDCDIFFTHYS----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------SLRRHQR-------------------------
-------------------------------VHTGEK-HTCKQCGKSFTRGSTLRAHQRI
HTGEKPYKCSKCDKSFI-QASQLRTHQ------------RVHTGERPYVCKECGKSLTTC
AILRAHQKIHTGEKPYKCMECG------------------------------------KS
YIQYSHLKRHQKVHTGEKHTIVNNVT
>gi|563623|emb|CAA57772.1|	   509 residues, 50 /line  putative DNA/RNA binding protein [Solanum tuberosum]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------MSIVTCEKAAASLSSSSN
MNNDTNGAFCYTPQHQLVTPQY-----QNPPQQIKKKRNQPGNPDPEAEVIALSP--KTL
VAA-NRFFCEICNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQLHR-RGHNLPWKLKKRENK---
-----------EVVRK--KVYICPESSCV---------HHDPSRALGDLTGIKKHFSRKH
----------------------------GEKKWKCEKCS--KRYAVQSDCKAHFKT-CGT
R----------------------------EYKC-ECGTIFSR--------------RDSF
ITHRAFCET------LAMESARSVINGRNPTIF--------------SPQLNLQFQQPHF
FNSHE-----------------QIQATTFPMK-------------------KEQQSSDFR
HIEIPP--WLITTNSQPFQLGA------------INHGPSPRSNFSS-------------
---------------------------------------------SSIFP-ATTRLDQQY
TQSG-------HKDLNLHHPN---------------------------------------
-------PNLRGPTLGYDSTGESGAVSPVH------------------------------
------ISATRLLQKAAQFGATISNKASAVT-ATAAYTGTVKIPHNTHVS----------
---------------------VTSTDSAT-----KQTHQKLSSREDLTSITGPANIS-GI
MTS-------------------FSNGFDG---------STMFE---------DAILFGGF
NNLNSKKEDEEEDQQLYFNGSMNE---------------EDHILTKDFLG-LKPLSH---
---------------------------------------------------------TDD
IFNIAALVNTE---PHHFKNHKTWQS
>gi|73957924|ref|XP_546971.2|	   546 residues, 50 /line  PREDICTED: similar to zinc finger protein 498 isoform 1 [Canis familiaris]
-MLKERPGMAEDPQQQMGV----------P----VVKLEKELPWGRGREDPSPETFRLRF
RQFRYQ-----------------------------------EAAGPQEALR-EL------
---Q--------ELCRQWLRPELHTKEQILEL--LV-----LEQFLTILPREFYAWIREH
GLESGKALVAMVEDFTERTLEAKAVPCH--------------------------------
--VQGEQQETALGRGPWEPGVHLGPVEVKPEWGMTHGEGVQGLDQGTEEQLSQDPGAGTQ
AFQEQ---ALPVLQAGPGLPPVNSRDQEMAAGFLTAGPQGLGSFKDMALAFPEEEWRH--
------------VTPAQIDCFGE----YVEPQDCGVSAPGIGSKEKEAKTQQVDLKGALA
RVT-SERFGEATLQSPELGRTC-------EQEPSSSVGNIPGPPPPQHGVVPLPDDLKTH
SSFWKPFQCPECGKGFS-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RSSNLVRHQ-RTHEEEKSYGCVECGK--
GFTLREYLMK------HQRTHLGKRP-----Y-----VCSECWKTFSQRHHLEVHQRSHT
----------------------------GEKPYKCGDCW--KSFSRRQHLQVHRRTHTGE
KPYTC-ECGKSFSRNANLAVHRRAHTGEKPYGCQVCGKRFSK--------------GERL
VRHQRIHT-GEKP-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------YHCPACGRSFN-QRSILNRHQ---------------------------------
------------------------------------------------------------
---------------KTQHRQETLAQ
>gi|125549370|gb|EAY95192.1|	   559 residues, 50 /line  hypothetical protein OsI_016425 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------MG-------------------------
----------------------I-------------------------------------
---------------------------------------------VPYISQD--------
-----------------------------KTKSVHFSR--FHASDPDAEVIALSP--KTL
LAT-NRFVCEVCNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------REQNLQLHR-RGHNLPWKLKQKNPA---
-----------QAQRR--RVYLCPEPTCV---------HHDPARALGDLTGIKKHFCRKH
----------------------------GEKKWKCDKCS--KRYAVQSDWKAHSKI-CGT
R----------------------------EYRC-DCGTLFSR--------------RDSF
ITHRAFCDA------LAQESSRLPPTSLSSLTSHLYGA-------SNAGNMALSLSQVGS
HLTTSLQDGGGHHHHPSPELLRLGGAGGGGGAGGG----SSIAARLDHLL-SPSGASAF-
-RPPQP--AFFLNAAAAAAATG------------QDFGDDAGNGQHSFLQA--KPF-HGL
MQLPDLQ---GNGAGGPGAP-------------------GPNLFNLGFFA-NNGNSSGSS
HEHA-------SQGLMSNDQFSGGAG----------GGGGSDASAAGIF--GGNFV-GGD
HVSPAG----LYND---------QAAMLPQ------------------------------
------MSATALLQKAAQMGATSSANGPG--------------------SMFRGFV----
-----------------------GSSPHM-----RPAAQHMD------------------
--QSDAHLNDL-MNSLAGGGVNAAAMFGGTN---GGG---VPGAGMF-------------
------------------DPRLCD----------------IEHEVKFSQG-GGGGGG-AG
AGTGD-----------------------GTRDFLGVGGGGI--VHGMSTPRGDHHQSSSD
MSSLEAEMK--SA-SS--FNGRRM-P
>gi|140064565|gb|ABO82700.1|	   519 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MVDLD-------------------------
----------------------N-------------------------------------
---------------------------------------------VSTASGEASISSSGN
NNI------------QSPIP-----------KPTKKKRNLPGMPDPEAEVIALSP--TTL
LAT-NRFVCEICNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQLHR-RGHNLPWKLRQRSSK---
-----------E-IRK--RVYVCPEPTCV---------HHDPSRALGDLTGIKKHFCRKH
----------------------------GEKKWKCEKCS--KKYAVQSDWKAHSKV-CGS
R----------------------------EYKC-DCGTVFSR--------------RDSF
ITHRAFCDA------LAEENAKSQNQAVGKANS-------------ESDSKVLTGDSLPA
VITTT-----------------AAAAATTPQSNSG----VSSALETQKLD-LPENPPQI-
--IEEP--QVVVTTTASALNAS------------CSSSTSSKSNGCAATST--GVF-ASL
FASSTAS---ASASLQPQAPAFSDLIRSMGCTDPR---PTDFSAPPSSEA-ISLCLS---
-----------------------------------------------------TSH-GSS
IFGTGG----QECR------QYVPTHQPPA------------------------------
------MSATALLQKAAQMGAAATNA-----------------------SLLRGLG----
-----------------------IVSSSA-----STSSGQQDSLH---------------
--WGLGPMEPE-GSSLVSAG--LGLGLPCDA---DSG---LKELMLG-------------
------------------TPSMFG----------------PKQTTLDFLG-LGMAA--GG
SAGGG-----------------------LSALITSIGGGSGLDVTAAAASFGNGEFS---
------GKD--IG-RS---------S
>gi|92870471|gb|ABE79766.1|	   517 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
------------------------------------------------------------
----------------MVK--GLMMFQQQQVV----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------EENMS-------------------------
----------------------N-------------------------------------
---------------------------------------------LTSASGEASVSSGNR
TEI-GTSSSYPQVQQQYLVPPT-------QSQPMKKKRNLPGNPDPDAEVIAMSP--KSL
LAK-NRFICEICNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQLHR-RGHNLPWKLKQRTSK---
-----------E-IRK--KVYVCPEPTCV---------HHDPSRALGDLTGIKKHFSRKH
----------------------------GEKKWKCEKCS--KKYAVQSDWKAHSKT-CGT
R----------------------------EYRC-DCGTLFSR--------------RDSF
ITHRAFCDA------LAEESARAMTNNAMPI---------------LPSQQQLSSSSSHH
HHMIN-----------------LQNQFNNPQQDLHNFPLLKKEQHNQSFN-LSEIPPWL-
--GPHN--VDNLSSSSSIFSQH------------HHHQENPNPSLVHVSGP--TL-----
------------------------------------------------------------
------------------------------------------------------------
--------------------PSYQTVPSAH------------------------------
------MSATALLQKAAQMGATMNRSGSASS--PAMNIKTHQVDSLNNVSGNFGLN----
-----------------------LLSSSQ-----EQQQHQQNTQETNTTSTYLNNIH-DV
MFSSSSSPSGF-EATHFDEM--FGGI--------MNS---KKDQNLH-------------
------------------HETSLS----------------KKPTSTAEDG-GGGGG--GG
GGNEG-----------------------LTRDFLGLRPLSHSDI-LSIAGIGNCMND---
------QQQ--QN-QS--QKPSWQ-G
>gi|147773683|emb|CAN63173.1|	   597 residues, 50 /line  hypothetical protein [Vitis vinifera]
MVLDGPITCHGAWGVVEVG----------VGWRIMQRNMKKSRKCPRLGSSMWGEARAS-
-----CPGSSSSV--HGHY--GELSDKNSNNGEQTAELKSNS------------------
------------LSAKLILLAGFSRKVVIFQE--AI------------------------
--------------TIVAYGNRLASIGLAVFLENFGF------------FVEGSSIEAVG
VRAR---DRMFLDPSGVESSVETLVGIRRIMVELDISSPM--------------------
----------------------T-------------------------------------
---------------------------------------------VSTASREASVTSSGN
QTA-----------------PQ-------PVAPTKKKRNLPGTPDPDAEVIALSP--KTL
MAT-NRFVCEICNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQLHR-RGHNLPWKLRQRTSK---
-----------E-VRK--RVYVCPEPTCV---------HHDPTRALGDLTGIKKHFCRKH
----------------------------GEKKWKCERCS--KKYAVQSDWKAHLKT-CGA
D----------------------------MTEN-PVGVLQQA------------------
-----------------------------PATISLTTG-------TVTSSSSSSTS----
------------------------------------------------------------
------------------------------------------------------VF-ASI
FAPSTTP---VTSQPPQSSSTFSDLICAMGRSKRSTTLPSSSTAEPTLRL-SSSLYX---
-----------------------------------------------------SNS-ASS
LFPTPD----QNH-------RHYAPSPQPA------------------------------
------MSATALLQKAAQMGAAASNA-----------------------SLLRGLG----
-----------------------LAMSPS-----SSAQQDSSTT----------------
--QWSGHVKAD-SNPVGAG---LGLGLPSEG---GPA---LTGLMMG-------------
------------------PSSLFV----------------NKPTTLDLLG-LGMVP--GG
ASTAG-----------------------LSALLTSISGGG-LDIAAAGSPFGGAAAA---
------TAE--AA-PDRKPNGPAL-L
>gi|15226866|ref|NP_178316.1|	   602 residues, 50 /line  ATIDD5 (ARABIDOPSIS THALIANA INDETERMINATE(ID)-DOMAIN 5); nucleic acid binding / transcription factor/ zinc ion binding [Arabidopsis thaliana]
------------------------------------------------------------
-----MAASSSSA--ASFF--GVRQD----------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------DQSHL--------------------
----------------------L-------------------------------------
---------------------------------------------PPNSSAAAPP-----
---------PPPPHHQAPLPPL-------EAPPQKKKRNQPRTPNSDAEVIALSP--KTL
MAT-NRFICEVCNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------REQNLQLHR-RGHNLPWKLKQKSTK---
-----------E-VKR--KVYLCPEPSCV---------HHDPSRALGDLTGIKKHYYRKH
----------------------------GEKKWKCDKCS--KRYAVQSDWKAHSKT-CGT
K----------------------------EYRC-DCGTLFSR--------------RDSF
ITHRAFCDA------LAQESARHPTSLTSLPSHHFPYGQNTNNSNNNASSMILGLSHMGA
PQNLDHQPG---------DVLRLGSGGGGGGAASRSSSDLIAANASGYF-----------
-MQEQN--PSFHDQQDH----H------------HHHQQGFLAGNNNIKQSPMSFQ-QNL
MQFSHDN---HNSAPS-------------------------NVFNLSFLSGNNGVTSATS
NPNAAAAAAVSSGNLMISNHYDGENA----------VGGGGEGS-TGLF--PNNLMSSAD
RISSGSVPSLFSSS-------MQSPNSAPH------------------------------
------MSATALLQKAAQMGSTSSNNNNGSN--------------------TNNNN----
-----------------------NASSIL-----RSFGSGIYG-----------------
--ENESNLQDL-MNSFSNPGAT---GNVNGV---DSP---FGSYGGV-------------
------------------NKGLSA---------------DKQSMTRDFLG-VGQIV--KS
MSGSGGFQQQQQQQQQQ----QQQQQHGNSRERVGSSSDSA-DRSSMNVNTG-------G
GPASTS----------PPYGIHHASF
>gi|15219567|ref|NP_171880.1|	   506 residues, 50 /line  zinc finger (C2H2 type) family protein [Arabidopsis thaliana]
------------------------------------------------------------
---------------------------------MTTEDQTIS------------------
------------SSG---------------------------------------------
-----------------------------------GY------------VQSSSTTDH--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------VDHHHH
D------------QHESLNP-----------PLVKKKRNLPGNPDPEAEVIALSP--KTL
MAT-NRFLCEICGKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQLHR-RGHNLPWKLKQRTSK---
-----------E-VRK--RVYVCPEKSCV---------HHHPTRALGDLTGIKKHFCRKH
----------------------------GEKKWKCEKCA--KRYAVQSDWKAHSKT-CGT
R----------------------------EYRC-DCGTIFSR--------------RDSF
ITHRAFCDA------LAEETARLNAAS------HLKSFAATAGSNLNY------------
------------------------------------HYLMGTLIPSPSLP-QPPSFP-F-
-GPPQP--QHHHHHQFPITTNN------------FDHQDVMKPASTLSLWS--GGN-INH
HQQVTIE---DRMAPQPHSPQ-EDYNWVF----------------------GNANNHGEL
I--------TTSDSLITHDNNINIVQ----------SKENANGA-TSLS-----------
------VPSLFSSVDQITQDANAASVAVAN------------------------------
------MSATALLQKAAQMGATSSTSPTT-------TITTDQSAYLQSFASKSNQI----
-----------------------VEDGGS-----DRFFASFGSNSVELMSNNNNGLH-EI
GN----------------------------------------------------------
----------------------------------------PRNGVTVVSG-MGEL-----
---------QNYPWKRRRVDIGNAGGGGQTRDFLGVGVQTI-------------------
----------------CHSSSINGWI
>gi|15240072|ref|NP_201474.1|	   500 residues, 50 /line  zinc finger (C2H2 type) family protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------MPVDLD-------------------------
----------------------N-------------------------------------
---------------------------------------------SSTVSGDASVSSTGN
QNL---------------TP----------KSVGKKKRNLPGMPDPDAEVIALSP--KTL
MAT-NRFVCEICNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQLHR-RGHNLPWKLRQRSTK---
-----------E-VRK--KVYVCPVSGCV---------HHDPSRALGDLTGIKKHFCRKH
----------------------------GEKKWKCEKCS--KKYAVQSDWKAHSKI-CGT
K----------------------------EYKC-DCGTLFSR--------------RDSF
ITHRAFCDA------LAEESAKNHTQSKKLY----------------PETVTRKNPEIEQ
KSPAA---VESSPSLPPSSPPSVAIAPAPAISVET----ESVKIISSSVL-PIQNSPESQ
ENNNHP--EVIIEEASRTIGFN------------VSSSDLSNDH---SNNN--GGY-AGL
FVSSTAS---PS--LYASSTAS----------------PSLFAPSSSMEP-ISLC-----
-----------------------------------------------------LST-NPS
LFGPTI---------RDPPHFLTPLPPQPA------------------------------
------MSATALLQKAAQMGSTGSGG-----------------------SLLRGLG----
-----------------------IVSTTS-----SSME----------------------
--LSNHDALS------LAPG--LGLGLPCSSGGSGSG---LKELMMG-------------
------------------NSSVFG----------------PKQTTLDFLG-LGRAVGNGG
NTGGG-----------------------LSALLTSIGGGGGIDL------FGSGEFS---
------GKD--IG-RS---------S
>gi|55418540|gb|AAV51390.1|	   583 residues, 50 /line  INDETERMINATE-related protein 10 [Zea mays]
------------------------------------------------------------
-----MASNSSAAAVAAMF--GIRDADHQDQMKPLLA-----------------------
------------------------------------------------------------
------------------------------------------------------------
--------QQHQHQHQHQMPPAPLL-----------------------------------
------------------------------------------------------------
-------------------------------------------------NAASSSAGPG-
-------------QAAGATP-----------PAVKKKRNL---PDPDAEVIALSP--KTL
LAT-NRFVCEVCNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------REQNLQLHR-RGHNLPWKLKQKDPS---
-----------QAQRR--RVYLCPEPTCA---------HHDPSRALGDLTGIKKHFCRKH
----------------------------GEKKWKCDKCS--KRYAVQSDWKAHSKV-CGT
R----------------------------EYRC-DCGTLFSR--------------RDSF
ITHRAFCDA------LAQESARLPPPGLTA--SHLYGA-------TNAANMGLSLSQVGS
HLASTLGA---DAHGHHQDLLRLGG--------------SNAASRFEHLL-GPSNASAFR
PLPPPPSSAFLMGRSAGVLAQG------------D------GSGSHGFLQGKPVPQSHAS
AGSPRQR---RRGASASS---------------------ATGLFNLGYIA-NSANSSGTS
SHGHA------SQGHLTSDQFSEG-G----------GGGGSESSAAMLFSGGGNFAGGDH
QVAPGGMY------------NNDPAVMLPQ------------------------------
------MSATALLQKASQMGSSASAHGGV--------------------SVFGGLV----
-----------------------GSSAPS-----ARHARAPMLD----------------
--QSQMHLQSL-MSSLAAGGMF---------GGANSG-SMIDPRMYD-------------
---------------MN-QDVKFSQGR------------GGAEMTRDFLG-VGG----DG
VMRGMTV------------------------------------------ARAGHQDGADD
MNSLEAEMKSA----SSPFTGDRM-Q
>gi|55418542|gb|AAV51391.1|	   518 residues, 50 /line  INDETERMINATE-related protein 7 [Zea mays]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------MQPQQG-------------------------
------------------------------------------------------------
---------------------------------------------SSSSLQQNSTSAPGA
AV----------------------------VPPPKKKRNQPGNPNPDAEVIALSP--RTL
LAT-NRFVCEVCNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------REQNLQLHR-RGHNLPWKLKQKNPR---
-----------E-ARR--RVYLCPEPTCV---------HHDPSRALGDLTGIKKHYCRKH
----------------------------GEKKWKCDKCS--KRYAVQSDWKAHSKT-CGT
R----------------------------EYRC-DCGTLFSR--------------RDSF
ITHRAFCDA------LARESAQMPPLGAGLY--------------VGPGSMSLGLSQIHG
FADQAQS--SSAAAAPQFDHIMPSSSG------------SSSMFRSQ--A-SASSPSYFL
GGSAPPAAAQDFSEDGSQGS------------------------QGPLLHGKAH-FHGLM
MQLPEQQHQPGSSNAAVGAN-------------------GSNILNLGFFSA--GNSGGTS
GSL-------QDARIAIQDQFNLSGS----------GSGSAEHGNNVMVASIGSHLGR--
-----GFPSLY---------SSSPSAGMAQ------------------------------
------NSATALLMKAAQMGSTTSSTTHNNHNGPTTTS-----------TLLRATG----
-----------------------FSG--------ATGSGQLGTTGGRAAAGEEGAA----
--SHEAHFHELIMNSLAGGG--------------------FSGTAGF-------------
------------------GGGVD----------------DGKLSTRDFLG-VGRGA--AT
MAPPGLHMG--------------------------------------------ALDPAQQ
M------------------------K
>gi|9858780|gb|AAG01127.1|AF273333_12	   519 residues, 50 /line  BAC19.12 [Lycopersicon esculentum]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------MPADPDNSSAM--------------------
----------------------N-------------------------------------
---------------------------------------------DSTGSGEASVSSSGN
QVV------------------P-------LKESAKKKRNLPGMPDPDAEVIALSP--TTL
LAT-NRFVCEICSKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQLHR-RGHNLPWKLRQRSSN---
-----------E-VKK--RVYVCPESSCV---------HHDPSRALGDLTGIKKHFCRKH
----------------------------GEKKWKCDKCS--KKYAVQSDLKAHSKI-CGT
R----------------------------EYKC-DCGTLFSR------------------
----AFCDA------LAQESAKTLPEKPPSTN-------------EEPKTQAVASSSPPP
SPPAPPPATESQPPPPPPAAPKSLMTPTVPPSTAV----MSFASSVQNRE-LRENPVTNS
A---GAATKQVVEEAAVVASLT------------GNCSSSCSNG---SSSSN---VFGSL
FASSTAS-----GSLPSQAPVFSDIFRAMAPEHTLEMAP---------------------
------------------------------------------PSSTEPISLGLAMSHSSS
IFRPA---------GQERRQ--YAPAPQPA------------------------------
------MSATALLQKAAQMGAAATSS-----------------------SFLRGIG----
-----------------------VMSSTS-----SSNGHQE-------------------
--WSGRPSDAN-GASLAAG---LGLGLPCDA---GSG---LKELMLG-------------
------------------TPSVFG----------------PKHPTLDLLG-LGMAA--SV
GPSPG-----------------------LSALLTSMGS--NLDMVTSAGSFGSADFS---
------GKD--LG-RN---------S
>gi|55418546|gb|AAV51393.1|	   544 residues, 50 /line  INDETERMINATE-related protein 1 [Zea mays]
------------------------------------------------------------
---------MAAASSAHLF--GLGD-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------GQMQMQPQQQQAP----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------PPPLVNNP-----------AAPPPKKKRNQPA--DPDAEVIALSP--KTL
MAT-NRFVCEVCNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDENLQLHR-RGHNLPWKLKQKNPK---
-----------ETRLR--RVYLCPEPTCV---------HHDPSRALGDLTGIKKHYCRKH
----------------------------GEKKWKCDKCN--KRYAVQSDWKAHSKT-CGT
R----------------------------EYRC-DCGTLFSR--------------RDSF
ITHRAFCDA------LAQESARVPPMGAGMY---------------GTGGMALGLSGMAT
SQLQSFQD-----QTHSSATTAIS---------------NNPTAQFEHLMQSSTGSPVFR
GAQPTSSS------SSPFYLGG------------AEDGHQSLSGHTSLLHGNKQAY-HGL
MLLPEQQHQAG----------------------------SNGLLNLGFFSG-GSSGQDAR
--------------LVFPDQFNGAVGGNVRGDGSEHGNSGANTESAAIF--SGNLMGNHQ
MASSAGFSSSLY--------NSSETAAPAQ------------------------------
------MSATALLQKAAQMGATTSSGNVN--------------------SLLRGLG----
-----------------------SSA--G-----GTLNGRPAGASAGFMAGESSSARSTS
QAENESQFRDL-MNTLAASGSG----------------AAGTAFSGG-------------
------------------FPGMD----------------DSKLSTRDFLG-VGGSV----
VRSMGGA----------------------AGLPLRHGGAAGI-----------------G
MGSLDTEM-----------------K
>gi|125563937|gb|EAZ09317.1|	   504 residues, 50 /line  hypothetical protein OsI_030549 [Oryza sativa (indica cultivar-group)]
----------------------------------------MLGSCA--------------
--PTTAGPPPDEATTPEP------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------F---RSL
QIA-----------------TA-------SAGSAKKKRRPAGTPDPDAEVVSLSP--RTL
LES-DRYVCEICNQGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQMHR-RRHKVPWKLLKREAG---
-----------EAARK--RVFVCPEPTCL---------HHDPSHALGDLVGIKKHFRRKH
---------------------------SGHRQWACARCS--KAYAVHSDYKAHLKT-CGT
R----------------------------GHSC-DCGRVFSR--------------VESF
IEHQDTCNA------SRGQAAAVAEGGNVSTA--------------ACGGVAVLE-QEKQ
LDLQAPAAASLSRTASST-------------------SPSSDVVASPVAWPGAWAPSMPS
PKAAAFRGR-FDMAPSPPPPSY------------DHYRGGAGAHNLELQLM--------P
PFNAGGAAAA--------------------------------------------------
----------------------------------------------------PGGMGACF
YAAAHQ------------HHPTGVSQCNDASTQLQLSIGRGEVMGAAGTSDEASAAATAK
EQAREQ-LRQAMAEKEAAGEARAQ--ARRQV------------------ELAEQELA---
---------------------T--------------------------------------
-------ARRMRHQAQVE---------------------------LSRAHALRDHAVRQV
NATLLQITCFSCRHKFR-AAAAGAPLP------------A------------AMSS----
-------------------------DVACSYVSSVVTEGGDADEPLDVVDATRRRLQ---
------HAN--SMGI----------M
>gi|147787378|emb|CAN60092.1|	   425 residues, 50 /line  hypothetical protein [Vitis vinifera]
----------------------------------------MLENTA--------------
--AASTAP----SSSSDA------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------F------
-TS-----------------LE-------NGVCNKRKRRPAGTPDPDAEVVSLSP--KTL
LES-DRYVCEICNQGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQMHR-RRHKVPWKLLKRETQ---
-----------E-VKK--RVFVCPEPSCL---------HHDPLHALGDLVGIKKHFRRKH
---------------------------SNHKQWVCEKCS--KGYAVQSDYKAHLKT-CGT
R----------------------------GHSC-DCGRVFSR--------------VESF
IEHQDACAV--------------------------------------------RQ-VRPE
LQTLQPACS--SRTASST-------------------SPSSDNNFSRVQLP---GLTLPK
PAETVFLCL-ERNN----------------------PSPSDLQHNLELRLL--------P
SPNTYSSRNS--------------------------------------------------
----------------------------------------------------DENHATHL
KLSIGS------------CNSGEMNEPRCASGDASRSS-----PREMNTAEPALAASRLK
ELASEQ-LKLAMAEKASAEEARRE--AKRQI------------------ELAELEFA---
---------------------N--------------------------------------
-------ARRIRQQAQAE---------------------------LEKAQILKEQAIKKV
SSTILQITCHACKHQFQ-ATAAGAP---------------------------SDET----
-------------------------SLAMSYMSSALTEGEG-------------------
-------------------------E
>gi|79549667|ref|NP_178303.2|	   445 residues, 50 /line  SGR5 (SHOOT GRAVITROPISM 5); nucleic acid binding / transcription factor/ zinc ion binding [Arabidopsis thaliana]
----------------------------------MRTDQVMLSNKN--------------
--TNTCCVVS--SSSSDP------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------FLSSSEN
GVT-----------------TT-------NTSTQKRKRRPAGTPDPDAEVVSLSP--RTL
LES-DRYICEICNQGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQMHR-RRHKVPWKLLKRDNN---
-----------IEVKK--RVYVCPEPTCL---------HHNPCHALGDLVGIKKHFRRKH
---------------------------SNHKQWVCERCS--KGYAVQSDYKAHLKT-CGT
R----------------------------GHSC-DCGRVFSR--------------VESF
IEHQDNCSA------RRVHR--EPP-------------------------------RPPQ
TAVTVPACS--SRTASTV-------------------STPS----SETNYGGTVAVTTPQ
PLEGRPIHQ---------RISS------------SILTNSSNNLNLELQLL--------P
LS-SNQNPNQ--------------------------------------------------
----------------------------------------------------ENQQQKVK
EP-SHH------------HNHNH-DTTNLNLSIAPSSS-----YQHYNNFDRIKEI----
-MASEQIMKIAMKEKAYAEEAKRE--AKRQR------------------EIAENEFA---
---------------------N--------------------------------------
-------AKKIRQKAQAE---------------------------LERAKFLKEQSMKKI
SSTIMQVTCQTCKGQFQ-AVAV--PAA------------T------------ADET----
-------------------------SLVVSYMSSANTDGEL-------------------
-----------ENG-----------F
>gi|125546364|gb|EAY92503.1|	   431 residues, 50 /line  hypothetical protein OsI_013736 [Oryza sativa (indica cultivar-group)]
-----MVKCPYPALCF--C----------LRWLVLQRRFHHRHGATLIFLTTPGEGSYSS
-LLSTMMMSSSVDHFSNNSNNNQAMYLEQDEDFSQMIMELCDFDASSTTQA-RH------
---GGEAAAGDAR-AVLTYLTFLEQKIGHLRG--II------------------------
SSTPNPPPQIVAAELSCIVVQLVSISKNL-------------------------------
------------------------AAARRGGDDAD-------------------------
------------------------------------------------------------
------------------------------------------------------------
-AD-----------------AKHDGSSDADEGGDGDGDGERAPPRGPYEVVQIEK--EEI
LAP-HVHFCGVCGKGFK-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDANLRMHM-RGHGDEYKSSAALAKP--
DAGGAPPSPSRSPARR--RFYSCPYVGCKR-N-----REHKSFQPLKTPICVKNHYRRSH
----------------------------CDKSFTCRRCN-VKKFSVVADLRTHEKH-CGR
D----------------------------RWVC-SCGTSFSR--------------KDKL
FAHVAIFDG-HSP-----ALPPE-DYDDDAAS--------------GQLPHAAGE-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------AVGRTVDTNR-FFSDG----
-------------------------LMIKGSMDDE------------RGTLSPMGLD---
------YCE--FDGIDLFAAAAFD-F
>gi|125582592|gb|EAZ23523.1|	   384 residues, 50 /line  hypothetical protein OsJ_007006 [Oryza sativa (japonica cultivar-group)]
----------------------------------MKSTTHLLAGGGGGGSVAPPTAATA-
PTLAMEVGDPSGALVGGAGGAGARGG----------------------------------
---------DGDARDALLRLVALGDRMAAVRR--RIAASI---------SGE-------S
GPLSSSDIHSVSSEISSAAHLVVLNAASL----LSSTVASLPAPPP--------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------PPATTVQ
ELP-----------------PVVVSVPQEP-------PQEAAKGDGDYDVVELDA--SEL
LAE-HVHFCDICGKGFR-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDANLRMHM-RAHGDRFKTLDALSRPGQ
PK--------PPAGRE--VRFSCPYAGCNR-N-----RAHRRFRPLKSAVCARNHFRRSH
----------------------------CPKLYACERCGGKKRFAVLADLRSHLRH-CGE
EA---------------------------QWRC-SCGTTFSR--------------KDKL
FGHLALFEG-HTP-----AIAEP-NKGVATAA--------------AEASISMME-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------EGGVEANCDREEDEEG----
-------------------------GFDPKFFQEWMEELRG-------GAVAPNWSA---
------PSE--AG------------H
>gi|140052210|gb|ABE80094.2|	   454 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MSP--KSL
MAT-NRFLCEICNKGFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQLHR-RGHNLPWKLKQRANK---
-----------DQIRK--KVYVCPEKTCV---------HHEPSRALGDLTGIKKHYSRKH
----------------------------GEKKWKCEKCS--KKYAVQSDWKAHSKI-CGT
R----------------------------EYKC-DCGTIFSSCGQCNRKRSFDMVGKDSF
ITHRAFCDA------LTEQSAKITTVPAALSN--------------F-RNDHLTNTQTPR
IPHIFPGFQ--FHSEFVN-------------------SATSSEPP----LGNYTNISQLH
QNSDIM----QTMDVFGSQPQW----------------LNYNNANLSLPML------HGV
MKQEQEENKD--------------------------------------------------
----------------------------------------------------LSASVISS
LYLSRS------------QNQNQQEAPNHL------------------------------
------SVTTSLLQKESQMGSTRTIITNDNN------------------TVFNNLNH---
---------------------FHIVHEVQ-----KFYNKQCESE----------------
---ELNELVNLEGSNSSTN---LGGGYLLNDSNNM------FGIVNGT---------KDL
DHVVLSVDKETTNRQMY-DSGSRSKEK------------NQMGFTRDFLG-VGEDD----
-------------------------SMSRPFLQQELGEFNG------MGSLGNNLQS---
------QYG--NG-HY---------C
>gi|147772174|emb|CAN64546.1|	   390 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------------------
------MIPVGTSNCFVNGSQGLQMYGMTAEGSVSSSLGGSSVL----------------
---------EAHSCSLVYSFSILKDKVHQVQS--LI-------SIFVP-----------P
NQGQPESMAMAVAGMGNLIQEVIAAASSM----MYSCQQMGYGAAPGNSG----------
-------TNHGLPQQGVELSDGRVCGDTGVV------------------------QMGEE
RGQGFYSSDQSLDWYGDNHNNSN-------------------------------------
---------------------------------------------TNDH------SRTII
VSN-----------------NDKVESRELPQGSTQMNEGLGGVXPKTFDIVELDA--EDL
LAK-YTHYCQICGKGFK-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDANLRMHM-RAHGDEYKSNAALSNP--
TKNIGREMENKDDLIKLPRKYSCPQEGCRW-N-----RKHAKFQPLKSMICVKNHYKRSH
----------------------------CPKMYICKRCN-QKQFSVLSDLRTHEKH-CGD
L----------------------------KWLC-SCGTTFSR--------------KDKL
MGHVALFVG-HTP-----AINSMSKP----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------IKF---
------HQN--A-SRL---------Q
>gi|30688719|ref|NP_197680.2|	   373 residues, 50 /line  zinc finger (C2H2 type) family protein [Arabidopsis thaliana]
--MHIHMMN-----------------------RDEHIAKKVEGSISSFS-----------
---------------------GETSTSSKQIYVNPVTTTGTKSM----------------
-------EDDDVSLSLLYNLSTLHEKVHQIQS--LV-------SFYMVSTNN-------I
NQ-SSGSTSLAVANIGSLVQEIITAASSM----LYTCQQLQIGSNNNNND----------
-------IDNDQTVDAMVLEFSRQETDPGHD-----------------------------
-----------FVQESTNLFGVQ-------------------------------------
---------------------------------------------ERGQISFP-----DQ
NLD-----------------WYNTETINP----KKD-KHRSKPSSGSYDILELDV--ADL
LAK-YTHYCQICGKGFK-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDANLRMHM-RAHGDEYKTREALISP--
TSQDKKGG---YSLKK--HYYSCPQHGCRW-N-----QRHEKFQPLKSVICAKNHYKRSH
----------------------------CPKMYMCRRCS-VKHFSVLSDLRTHEKH-CGD
I----------------------------KWVC-SCGTKFSR--------------KDKL
MSHVSLFLG-HVP-----AHGSSKPPTIT-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------L---------K
>gi|90265111|emb|CAC09473.2|	   371 residues, 50 /line  H0806H05.6 [Oryza sativa (indica cultivar-group)]
--MNPQEFQ--------------------------------FFQGVEQEMLLLSHGGGGA
------------------------------------------------------------
-------AAAASDDVLAYHVGVLRDKVQQLEP--LV-------GMVVVSPAA-------P
HGQLRRDAAAMAASSACSVLQEITAAASA----VAHRLEQASAASSASFR----------
RGVAFADDAHAAGGEQMFAAGAH--------------------------------GGGQG
GDDEA--------------GASL-------------------------------------
---------------------------------------------FHHHGPPAVGAPTVF
RAG-----------------ATTTAAASS----SGG-GDDDGDGDGEVDVVELEA--SYL
LAR-YTHYCQVCGKGFK-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDANLRMHM-RAHGDEYKTAAALTSTGA
GM--------RAAARR--CSYSCPAEGCRW-N-----RRHPRFQALKSVVCAKNHYRRSH
----------------------------CPKMYVCGRCG-GKQFAVLSDLRTHEKH-CGE
L----------------------------RWLC-SCGTFFSR--------------KDKL
MGHVALFAAGHAP------VPVAPEASPSTTT--------------TGTTTDRSR-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------TGLI---------D
>gi|91094355|ref|XP_970090.1|	   405 residues, 50 /line  PREDICTED: similar to ATM/ATR-Substrate Chk2-Interacting Zn2+-finger protein [Tribolium castaneum]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------MEKVYPSI--DDL
SNV-NKKSCPECSALFN-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------SDSNLNLHLAKTHKKP-KLLEPTNP---
---------------N--KIFYCPITTCSYHN-----TSH-----FKQFKPLKQHFLKVH
----------------------------SDKNFLCTLCQ--KGFATESSRNKHTEY-CDV
-----------------------------AFKCCDCDVSYSC--------------YETL
KTHSRRKK-HNILEKVAYKTSLPPSVKNPKSD--------------DSLATNRLRLILPK
P------------SNSTG-------------------MIDTSEQS----VQTDKSNNSQE
TQTFLA--A-RLPQFTVETQTI----------------GDYFTKK-PVKST------ELK
NIKTQTIAPV--------------------------------------------------
----------------------------------------------------AKTSSCNT
LFNLDD------------FVLSVMEDMQR-------------------------------
-------------------------SSSSTQ------------------TNICEESE---
---------------------NIYSASTSTHDSIHTDTSDL-LN----------------
---DTFDSNFFNMETQTDF---DDLFKYCDDYSNMYT-QTCHELLLGKIGLNDTQTQTVF
DDVLKSVESQTVMSQFK-VLPASCKDN------------A---------------T----
-------------------------HMETQTDTHFM------------------------
-------QM--LEEIN---------A
>gi|125528447|gb|EAY76561.1|	   366 residues, 50 /line  hypothetical protein OsI_004408 [Oryza sativa (indica cultivar-group)]
--MEGEVVA--------------------------------------------ASPFF--
EWLKPPPRPASSSSWSSSFSSSSSMASRDQETVVPGEDGGGEIQ----------------
------------------------------------------------------------
---------------------EDHKSGMTCLPLLSMLEE-------------GNSK-RHE
HPVKEEIMSSAHAAGVVEPGVELNIGLPVTGSSAQEVT------MEEDDEEEDDDDVG--
--------EEEMDEWKPMHGGCK-------------------------------------
---------------------------------------------VEGDEEQYGEAVASV
EGS-----------------SSITAVGDM----FGGVGAESGVAMSSRYWIPTPA--QIL
VGP-VQFICHVCNKTFN-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RYNNMQMHM-WGHGREYRKGPESLKGTQ
-------T--LAMLKL--PCYCC-AAGCKN-N-----VAHPRARPLKDFRTLQTHYKRKH
----------------------------GAKPFRCRRCA--KPFAVKGDWRTHEKN-CGK
-----------------------------RWFC-ACGSDFKH--------------KRSL
NDHVRSFGAHHLP------VAESAAAAATTPA----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------D----------------------KDR---
------IIS--FQR------------
>gi|42407670|dbj|BAD08819.1|	   438 residues, 50 /line  putative transparent testa [Oryza sativa (japonica cultivar-group)]
--MEDPYTSFFKNP-----------------------YYYYCTSASSFPTAPAAAAAA--
AHLPPPLPPPYAALYPTAGGVGVGVGAHHHHQYPPAAFFHPPPVHQQHQAP-PS------
---PP--LREAL-----------------PLL--SLSPTPARRGGVVDAAAD-------S
DSDDDDDGDCC---YHHLQDQEGAAAGSTATPAAAAARAPLFADLNCIPTCCGDDN-DGG
DPMDVEV---AGTTADIDAAVALRIGLPAGGTEADLLSGLTGAGVEHEEEEED-------
------------------------------------------------------------
------------------------------------------------------CKVDG-
GGS-----------------GGDDEVVPL-----GFSSTPIGKLNKGQYWIPTPS--QIL
IGP-TQFSCPVCFKTFN-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RYNNMQMHM-WGHGSQYRKGPESLRGVQ
-------P--TAMLRL--PCYCC-AAGCRN-N-----IDHPRARPLKDFRTLQTHYKRKH
----------------------------GLKPFLCRKCG--KAFAVKGDWRTHEKN-CGK
-----------------------------LWYC-LCGSEFKH--------------KRSL
KDHARAFGHAHTA------LDADDDDGAVSDA----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------D----
-------------------------AVVRPSS----------------------SMA---
------ASS--LQPPP---------R
>gi|51091889|dbj|BAD36700.1|	   385 residues, 50 /line  putative WIP1 protein [Oryza sativa (japonica cultivar-group)]
--MHPHLYQ---------------------------------------------------
--------------------------SHHHH---------------QHVAP-PT------
---K---------------------------------------HGGGGAGAG-------G
EEDDQS------------------------MLLLSLWPP-------------GHSSHHHQ
HHHHGAASSSACSSASISAAAHSGGGGGGHGAAAAAAS------SWFNPSHYHGGGGGGG
GFLFQEQQEPNVSISLSIAPPCG-------------------------------------
---------------------------------------------VSGGNAAAMAAAGSF
ATS-----------------PLPQQPVAS----SAVATAAGGGQAPSQYWIPSAA--EIL
VGS-TQFSCAVCNKTFN-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RFNNMQMHM-WGHGSQYRKGSESLRGAI
TVGGAAPP--ASLMRL--PCYCC-AEGCRN-N-----VEHPRARPLKDFRTLQTHYRRKH
----------------------------GARPYACRRCG--KRFAVRGDWRTHEKN-CGK
-----------------------------LWFC-VCGSDFKH--------------KRSL
KDHVRSFGGGHAP-----HIVESSSTGAGGGG----------------------------
-----------------G-------------------CGGAG------------------
AD----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------DDD------DEYYDDD------------D---------------D----
-------------------------TVSLSRA----------------------TSA---
------HDD--ADMIV---------V
>gi|125535923|gb|EAY82411.1|	   478 residues, 50 /line  hypothetical protein OsI_036370 [Oryza sativa (indica cultivar-group)]
--------------MD--------------RDQMMNTMRDQAANLTSMNPLFYPFMADDA
-------------------LLGMAPPPPQQ--------------LLPSVSI-QH------
-------MDWSPDT-MLDNLTFIEEKIRQVKD--VI-------RSMAGRRAS-------S
SSAATPEQQLVNADLTCLIVQLISTAGSL----LPSLKNSSFLSRTTPPP----------
-------AAAAGAAQAVSLAAGESSSSARNN-ETNRED---EEE-------MGSPDYD--
---------ELFKG-------WT-------------------------------------
---------------------------------------------NGGAMDEF-----VG
AAG-----------------DEQDARENP----AAA-AAAAEEEEEKYEVLQLEE--DEI
LAP-HTHFCGICGKGFK-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDANLRMHM-RGHGDEYKSAAALAKP--
PPPPEGE-----EQPE--RRYSCPHAGCKR-N-----RMHASFQPLKTILCVKNHYKRSH
----------------------------CEKRHVCGRCG-AKRFSVMADLKTHEKH-CGR
D----------------------------RWLC-SCGTTFSR--------------KDKL
FAHVALFQG-HAP-----ALPPPPPPPPTTTT--------------STAASGRRRHKQEE
T------------EFTWG-------------------GGGGG------------------
DEFLDV--K-GIAGV---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------GSGSGGG
DEFFSAGSFGAMDF------GFGQLDA------------S---------------L----
-------------------------AMLLPSESEQF------------------AGD---
------HQE--ENGDD---------K
>gi|140053392|gb|ABE79513.2|	   366 residues, 50 /line  Peptidase S26A, signal peptidase I; F-box protein interaction domain; Zinc finger, C2H2-type [Medicago truncatula]
--MQMKCVCKSWNTLI--------------SEPFFVKMHLKEYNTVKMH-LNYQVMKRSA
RNPNLALPIRKRQKYTTPWFCGVVPIPYQY--------------LIYSRIN-QS------
---PL--LGYHPRSGFLIGSYNGLLHFREPQN--THKVVAFRPGGLEVKVFN-------L
GDNIRRDIQSLPVIPYFEINEGVYFSGSIHWLALYNYSHSLYEWAGITID----------
-------QFAIIISLNLSTETYNKLLLPRGFNEVTREVPILRVL-------NNHLCFS--
---------HEFKGTHLIIWQMT-------------------------------------
---------------------------------------------KYGVEESW-----NQ
LLK-----------------ISH-----------------QNLPNPEAEVISLSP--KPL
MAT-NRFVCEICLKDFQ-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RDQNLQLHR-RGHNLPWKLKQRTSK---
------------KIRK--RVYVCPEKIRVH---------NHPSRALGDLTGIKKHFCRKH
----------------------------GEK-----KC--SKFYVVQSDWKAHS------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------
>gi|114680320|ref|XP_001164420.1|	   350 residues, 50 /line  PREDICTED: hypothetical protein, partial [Pan troglodytes]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--E-KQYKCDVCGKVFNRKRNLVCHRRCH-------------------------------
------------------------------------------------------------
------------------------------------------------TGEKPYRCNECG
KTFGQTYSLTCHRRLHTGEKPYKCEECDKAFSFKSNLKRHR-RIHAGEKPYKCNDCGK--
TFSQTSSLTC------HRRLHTGEKP-----F-----KCNECGKTFSRKSSLTCHHRLHT
GEKPYKCNECGKTFSQELTLKCHRRLHTGEKPYKCNECG--KVFNKKANLARHHRLHSGE
KPFK----------------------------CTECVKTFSR--------------NSAL
VIHKAIHI-GEKRYK-----CNECGKTFSRIS----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------ALVIHTA-------------------------
-------------------------------IHTGEKPYKCNECGKGFNRKAHLACHHRL
HTGEKPYKCNECGKVFN-RKTHLAHHHRLHTGDKPYKC------------NECGKVFNQK
AHLARHHRLHTGEKPYKFNECGKVFN----------------------------------
--------------------------
>gi|73986864|ref|XP_542049.2|	   598 residues, 50 /line  PREDICTED: similar to zinc finger protein 617 [Canis familiaris]
--MKDKYCE------QDSV----------AFEDVAVNFTLEEWALLEP------------
---------------------------------SQKKLYRDVMQETLRNLA-SIGK-TWK
DYNSEDQYKNQGRKLRSHMVERLNQSKEGSQC----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------GGNFSPIPNLNLNK--KTY
TEV-KPWECNVCGKVFMRHSSLNRHKRSHTSPKPYKYQE---------YGKKPYKCKECG
KAFSYLQPFQKHERNHSVEKSYKCKECGKSFRYRQSV-----------------------
-----------------------------------------RKHERTHTGEKPYQCKQCG
KAFRYHQTFQTHERTHTGEKPYQCKQCGKALSCPSSFRSHE-RTHTGEKPYECKKCGK--
AFSCPSSLRK------HERTHTGEKP-----YDFGPYKCKECGKAFSCPSSYRIHERSHT
GEKPYECKQCGRAFSCSSSFRTHERTHTGEKPYQCKECG--KAFHWLTTFQVHVRTHTGE
KPYICKQCGKALSCPTSFRRHERTHTAEKPYECKQCGKTFSS--------------PLGL
QIHGRTHT-GEKPYK-----CEECGKAFVSLT----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------SFRRHMM-------------------------
-------------------------------THTGDGPYKCKECGKAFNCPSSFRIHERT
HTGEKPYECKICGKAFS-CSSYVQVHERTHTGEKPYEC------------KECGKAFIYR
TTFRGHMRVHTGEKPYKCKECGKAFSRP-----------------SSFRSHERIHTGEKL
LECKHCGKAFNWPTSLHKHVMRMHTR
>gi|148667182|gb|EDK99598.1|	   453 residues, 50 /line  zinc finger protein 9, isoform CRA_a [Mus musculus]
-----MTKY------KGPV----------TLRDVAVEFSKAEWKLLTP------------
---------------------------------AQKSLYKNVMLETFSNLF-SVGYRVVK
PSVIAKLKKG--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------KEPWPLEEFFRKSRGDKRRTAHDPRAKHQEQ
QAGNARRELTKHQKTPTRHESYDCSECGKSFCQKSSL-----------------------
-----------------------------------------LAHQETHT-KKSYKCEKCG
QAFYKNEDLTIHQKVHTRDKTYPCKECNKIFYHLSSLTRHL-RIHAGEKPYECSQCDK--
SFYQKPHLTE------HQKTHTGEKP-----F-----ECKECGKFFYVKAYLLVHQKTHT
GEKPFQCKECGKFFSQKSHLTVHQRTHTGEKPYKCKECG--KLFSRNSHLKTHQRTHTGE
KPYK----------------------------CKECGNCFYQ--------------KSAL
TVHQRTHT-GEKPFE-----CSKCGKHFYYKS----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------DLTKHER-------------------------
-------------------------------KHTGEKPYECAECGKSFSVNSVLRLHERT
HTGEKPYECEICGKSFS-QKSHFVIHQRKHTGEKPYEC------------QECGEGFIQK
SQLTSHQKTHSKK-----------------------------------------------
------GKAN---------------K
>gi|148698290|gb|EDL30237.1|	   547 residues, 50 /line  zinc finger protein 31, isoform CRA_g [Mus musculus]
--MMAVA-S------PPPE----------PEDLLIVKLEEDSWGSDSR------------
---------------------------------PEKESHSPVPGPEVSRRC-FRQFRYRD
AAGPHEAFSQLWALCCRWLRPELRLKEQILEL----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------LVLEQFLSILPREV--QTW
----------------VQARHPESGE----EAVALVEDWHREAWAASSCPPGTCPFYEEM
DSL--MRARTVIRAVEMVGEATGLPGSGQSSTEADDQEAWGEMEDEDAVRLLTPDSQPAD
AGFELKREEEDQISEQDVLGDLPGALSRYTTKAVCQPCDWGEDHVNGNEGEWRNTWEECS
SEE-DLEKLIDHQGLYLTEKPYGCDTRAKSFSRKVHFFAPQ-RTHSSEKPYKCLGSGK--
SFSDRANLST------HQRIHIGEKP-----Y-----RCLECGKSFNDPSNLITHQRTHT
GEKPYKSCH----------------PNSGEKLYSCPECG--RCFSKSSALTSHQRIHSGE
KPYE----------------------------CAVCGKSFSK--------------SSSL
ANHRRTHT-GEKPHK-----CADCGKCFSERS----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------KLITHQR-------------------------
-------------------------------VHTGEKPYECPECGKFFRDRSNLITHQRI
HTGEKPYECRECGKCFN-QSSSLIIHQRIHTGEKPYKC------------TECGKDFNNS
SHFSAHRRTHAGGKA---------------------------------------------
-------------------------L

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.