FANDOM


&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g02070-2i13A.pir.txt

======================================================

Assigned types to 602 residues in Sequence 2-02070, 5 remain unknown
Assigned types to 171 residues in Sequence 2i13A, 436 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file At2g02070-2i13A.pir.txt into sequence alignment.

======================================================

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

>2I13.pdb  Made from 4082 ATOM records in 2I13.pdb
FSRSDHLAEHQRTHKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPEC
GKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKP
YKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRT
HKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRH
QRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQL
AHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTRRDALNXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

======================================================

Best alignment:
2I13.pdb    27  SDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTH---------    67
                SD + +    +T      + C  C K F +  NL+ H+R H         
2-02070     63  SDAEVIALSPKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQK   112

2I13.pdb    67  -TGE---KPYACPE--C-----GKSFSQLAHLRAHQRTHTGEKPYKCPEC   106
                 T E   K Y CPE  C      ++   L  ++ H     GEK +KC +C
2-02070    113  STKEVKRKVYLCPEPSCVHHDPSRALGDLTGIKKHYYRKHGEKKWKCDKC   162

2I13.pdb   107  GKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQ   148
                 K ++ + +   H +T  G K Y+C +CG  FSRRD+   H+
2-02070    163  SKRYAVQSDWKAHSKT-CGTKEYRC-DCGTLFSRRDSFITHR   202

======================================================

Highlighted IDENTICAL residue SER   60  index1   27  path   63  %Seq  50.00
Highlighted IDENTICAL residue ASP   61  index1   28  path   64  %Seq  50.00
Highlighted IDENTICAL residue LYS   62  index1   29  path   65  %Seq  50.00
Highlighted IDENTICAL residue LYS   63  index1   30  path   66  %Seq  50.00
Highlighted IDENTICAL residue ASP   64  index1   31  path   67  %Seq  50.00
Highlighted IDENTICAL residue LEU   65  index1   32  path   68  %Seq  50.00
Highlighted IDENTICAL residue THR   66  index1   33  path   69  %Seq  50.00
Highlighted IDENTICAL residue ARG   67  index1   34  path   70  %Seq  50.00
Highlighted IDENTICAL residue HIS   68  index1   35  path   71  %Seq  50.00
Highlighted IDENTICAL residue GLN   69  index1   36  path   72  %Seq  50.00
Highlighted IDENTICAL residue ARG   70  index1   37  path   73  %Seq  50.00
Highlighted IDENTICAL residue THR   71  index1   38  path   74  %Seq  50.00
Highlighted IDENTICAL residue HIS   72  index1   39  path   75  %Seq  50.00
Highlighted IDENTICAL residue THR   73  index1   40  path   76  %Seq  50.00
Highlighted IDENTICAL residue GLY   74  index1   41  path   77  %Seq  50.00
Highlighted IDENTICAL residue GLU   75  index1   42  path   78  %Seq  50.00
Highlighted IDENTICAL residue LYS   76  index1   43  path   79  %Seq  50.00
Highlighted IDENTICAL residue PRO   77  index1   44  path   80  %Seq  50.00
Highlighted IDENTICAL residue TYR   78  index1   45  path   81  %Seq  50.00
Highlighted IDENTICAL residue LYS   79  index1   46  path   82  %Seq  50.00
Highlighted IDENTICAL residue CYS   80  index1   47  path   83  %Seq  50.00
Highlighted IDENTICAL residue PRO   81  index1   48  path   84  %Seq  50.00
Highlighted IDENTICAL residue GLU   82  index1   49  path   85  %Seq  50.00
Highlighted IDENTICAL residue CYS   83  index1   50  path   86  %Seq  50.00
Highlighted IDENTICAL residue GLY   84  index1   51  path   87  %Seq  50.00
Highlighted IDENTICAL residue LYS   85  index1   52  path   88  %Seq  50.00
Highlighted IDENTICAL residue SER   86  index1   53  path   89  %Seq  50.00
Highlighted IDENTICAL residue PHE   87  index1   54  path   90  %Seq  50.00
Highlighted IDENTICAL residue SER   88  index1   55  path   91  %Seq  50.00
Highlighted IDENTICAL residue GLN   89  index1   56  path   92  %Seq  50.00
Highlighted IDENTICAL residue ARG   90  index1   57  path   93  %Seq  50.00
Highlighted IDENTICAL residue ALA   91  index1   58  path   94  %Seq  50.00
Highlighted IDENTICAL residue ASN   92  index1   59  path   95  %Seq  50.00
Highlighted IDENTICAL residue LEU   93  index1   60  path   96  %Seq  50.00
Highlighted IDENTICAL residue ARG   94  index1   61  path   97  %Seq  50.00
Highlighted IDENTICAL residue ALA   95  index1   62  path   98  %Seq  50.00
Highlighted IDENTICAL residue HIS   96  index1   63  path   99  %Seq  50.00
Highlighted IDENTICAL residue GLN   97  index1   64  path  100  %Seq  50.00
Highlighted IDENTICAL residue ARG   98  index1   65  path  101  %Seq  50.00
Highlighted IDENTICAL residue THR   99  index1   66  path  102  %Seq  50.00
Highlighted IDENTICAL residue HIS  100  index1   67  path  103  %Seq  50.00
Highlighted IDENTICAL residue THR  101  index1   68  path  114  %Seq  50.00
Highlighted IDENTICAL residue GLY  102  index1   69  path  115  %Seq  50.00
Highlighted IDENTICAL residue GLU  103  index1   70  path  116  %Seq  50.00
Highlighted IDENTICAL residue LYS  104  index1   71  path  120  %Seq  50.00
Highlighted IDENTICAL residue PRO  105  index1   72  path  121  %Seq  50.00
Highlighted IDENTICAL residue TYR  106  index1   73  path  122  %Seq  50.00
Highlighted IDENTICAL residue ALA  107  index1   74  path  123  %Seq  50.00
Highlighted IDENTICAL residue CYS  108  index1   75  path  124  %Seq  50.00
Highlighted IDENTICAL residue PRO  109  index1   76  path  125  %Seq  50.00
Highlighted IDENTICAL residue GLU  110  index1   77  path  126  %Seq  50.00
Highlighted IDENTICAL residue CYS  111  index1   78  path  129  %Seq  50.00
Highlighted IDENTICAL residue GLY  112  index1   79  path  135  %Seq  50.00
Highlighted IDENTICAL residue LYS  113  index1   80  path  136  %Seq  50.00
Highlighted IDENTICAL residue SER  114  index1   81  path  137  %Seq  50.00
Highlighted IDENTICAL residue PHE  115  index1   82  path  138  %Seq  50.00
Highlighted IDENTICAL residue SER  116  index1   83  path  139  %Seq  50.00
Highlighted IDENTICAL residue GLN  117  index1   84  path  140  %Seq  50.00
Highlighted IDENTICAL residue LEU  118  index1   85  path  141  %Seq  50.00
Highlighted IDENTICAL residue ALA  119  index1   86  path  142  %Seq  50.00
Highlighted IDENTICAL residue HIS  120  index1   87  path  143  %Seq  50.00
Highlighted IDENTICAL residue LEU  121  index1   88  path  144  %Seq  50.00
Highlighted IDENTICAL residue ARG  122  index1   89  path  145  %Seq  50.00
Highlighted IDENTICAL residue ALA  123  index1   90  path  146  %Seq  50.00
Highlighted IDENTICAL residue HIS  124  index1   91  path  147  %Seq  50.00
Highlighted IDENTICAL residue GLN  125  index1   92  path  148  %Seq  50.00
Highlighted IDENTICAL residue ARG  126  index1   93  path  149  %Seq  50.00
Highlighted IDENTICAL residue THR  127  index1   94  path  150  %Seq  50.00
Highlighted IDENTICAL residue HIS  128  index1   95  path  151  %Seq  50.00
Highlighted IDENTICAL residue THR  129  index1   96  path  152  %Seq  50.00
Highlighted IDENTICAL residue GLY  130  index1   97  path  153  %Seq  50.00
Highlighted IDENTICAL residue GLU  131  index1   98  path  154  %Seq  50.00
Highlighted IDENTICAL residue LYS  132  index1   99  path  155  %Seq  50.00
Highlighted IDENTICAL residue PRO  133  index1  100  path  156  %Seq  50.00
Highlighted IDENTICAL residue TYR  134  index1  101  path  157  %Seq  50.00
Highlighted IDENTICAL residue LYS  135  index1  102  path  158  %Seq  50.00
Highlighted IDENTICAL residue CYS  136  index1  103  path  159  %Seq  50.00
Highlighted IDENTICAL residue PRO  137  index1  104  path  160  %Seq  50.00
Highlighted IDENTICAL residue GLU  138  index1  105  path  161  %Seq  50.00
Highlighted IDENTICAL residue CYS  139  index1  106  path  162  %Seq  50.00
Highlighted IDENTICAL residue GLY  140  index1  107  path  163  %Seq  50.00
Highlighted IDENTICAL residue LYS  141  index1  108  path  164  %Seq  50.00
Highlighted IDENTICAL residue SER  142  index1  109  path  165  %Seq  50.00
Highlighted IDENTICAL residue PHE  143  index1  110  path  166  %Seq  50.00
Highlighted IDENTICAL residue SER  144  index1  111  path  167  %Seq  50.00
Highlighted IDENTICAL residue ARG  145  index1  112  path  168  %Seq  50.00
Highlighted IDENTICAL residue GLU  146  index1  113  path  169  %Seq  50.00
Highlighted IDENTICAL residue ASP  147  index1  114  path  170  %Seq  50.00
Highlighted IDENTICAL residue ASN  148  index1  115  path  171  %Seq  50.00
Highlighted IDENTICAL residue LEU  149  index1  116  path  172  %Seq  50.00
Highlighted IDENTICAL residue HIS  150  index1  117  path  173  %Seq  50.00
Highlighted IDENTICAL residue THR  151  index1  118  path  174  %Seq  50.00
Highlighted IDENTICAL residue HIS  152  index1  119  path  175  %Seq  50.00
Highlighted IDENTICAL residue GLN  153  index1  120  path  176  %Seq  50.00
Highlighted IDENTICAL residue ARG  154  index1  121  path  177  %Seq  50.00
Highlighted IDENTICAL residue THR  155  index1  122  path  178  %Seq  50.00
Highlighted IDENTICAL residue THR  157  index1  124  path  179  %Seq  50.00
Highlighted IDENTICAL residue GLY  158  index1  125  path  180  %Seq 100.00
Highlighted IDENTICAL residue LYS  160  index1  127  path  182  %Seq 100.00
Highlighted IDENTICAL residue TYR  162  index1  129  path  184  %Seq 100.00
Highlighted IDENTICAL residue CYS  164  index1  131  path  186  %Seq 100.00
Highlighted IDENTICAL residue CYS  167  index1  134  path  189  %Seq 100.00
Highlighted IDENTICAL residue GLY  168  index1  135  path  190  %Seq 100.00
Highlighted IDENTICAL residue PHE  171  index1  138  path  193  %Seq 100.00
Highlighted IDENTICAL residue SER  172  index1  139  path  194  %Seq 100.00
Highlighted IDENTICAL residue ARG  173  index1  140  path  195  %Seq 100.00
Highlighted IDENTICAL residue ASP  175  index1  142  path  197  %Seq 100.00
Highlighted IDENTICAL residue HIS  180  index1  147  path  202  %Seq 100.00
Highlighted 108 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g02070-2i13A.pir.txt.2I13.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g02070-2i13A.pir.txt PIR amino_acid 2I13.pdb A 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.