Fandom

Proteins Wiki

At2g02060.1/MSA

< At2g02060.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|18395292|ref|NP_565281.1|	   626 residues, 50 /line  calcium-dependent protein kinase-related / CDPK-related [Arabidopsis thaliana]
----------------MGKSSGRNGNGSFN------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------GNKFHGVRPYVRSPVPRLRWTPDLHRCFVHAVEILGGQH---------RAT
PKLVLKMMDVKGLTISHVKSHLQ--------MYRGGSKLTLEKPEESSSSSI--------
------------RRRQD---SEEDYYLHDNLSLHTRNDCLL-------GFHSFPLS----
-------------SHSSFRGGGGGRTKEQQTSESGGYDDDADFLHIKKMNDTTTFLSH-H
FPKGTEEWREQEHEEEEEDLSLSLSLNHHHWRS---NGSSVMNLSNRFGSNSKTAILNDS
YSDENH--SSSAAAAVTSVVIPPC---------SGNVLRAVLLLFFICFCFSLYRTSGYL
RIVSDSSSTLSRIFPSVNDSSSSPSPSPSLSPEEIEEPKLEEVLRRAATKDGTVILTTLN
E-AWAAPGSVIDLFFESFRIGKGTRRLLKHLVIIALDAKAYSRCQELHKHCFR-------
------------------------LETE-G-VD---FSGGEAYFMTPSYLTMMWRRIS-F
LRSV--LEKGYNFVFTDADVMWFRNPFRRFYEDGDFQIACDHYIGRPNDFRNRPNGGF--
TFVRANNRSIGFYKFWYDSRTKYPKNHDQDVL----NFIKTDPFLWKLRIRIRFLNT---
-----VYFGGFCEPSKDLNLVCT---MHANCCFGLDSKLHDLRIMLQDWRDF--------
----------KSLPLH--------------------------------------------
---------------------------------------------------------SNQ
SSGFTWSVPQNCSLDSLR------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------PVDSKDEEESE-PPGESTQ---------
>gi|115452811|ref|NP_001050006.1|	   428 residues, 50 /line  Os03g0329900 [Oryza sativa (japonica cultivar-group)]
------------MSSS--LPIL--PKSLKDI-----------------------------
------------------PRSHNTQNILMPG-QLPNDSMPLHQSA---------------
------------------TQSSISHPRASVVRSSYSAM---------------LGYAA--
---------------NPIDS------------VSSHEGHFMA-AP---------------
---------FISQSSNAEMLQY---LC-------NNNT--HGGHT---------------
----------------------------------------VPTFFPAPACG---------
-------APDYMDTIT----VPDNHT--------------QSGSSTVTS--DAAKQNEWW
AD------IMNDDWK-DILDATATD------SQSKSMAQPSNSAASQPAF-----NQSTS
SHSGDICPVTS-PPPNNSNASASKQRMRWTPELHESFVHAVNKLGGSE---------KAT
PKGVLKLMKVDGLTIYHVKSHLQ--------KYRTARYKPDLSEGKT--QE---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------GKTTDEL--------
SL----------------------------------------------------------
--------------------------------------------------DLKASMDL--
TEALRLQMEVQKRLHEQ----LEIQRK---------------------L-QLR-------
----------IEEQGKYLQKMFEKQC-------------KSSTQSV-----QDPSSG---
---DTATPSEPSNS-----V-------DKDS-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------EAALDPNRIGDN
HPKNSTNVGANLKTAATESPDSPV------------------------------------
-------------------IATDGSELPQE-KRRRVHE--------S
>gi|115469808|ref|NP_001058503.1|	   479 residues, 50 /line  Os06g0703900 [Oryza sativa (japonica cultivar-group)]
------------MSSQ--SVVA--VKQITAPDKIV-------------------------
-----------ETCPSTKHSAHKLFDVKPDF-Q---GLID-DNLS---------------
------------------SSSQSSSIKIELIRSSSLPNILPFQ---------KRSSEP--
---------------EPESPLSHVSHPNVSEPVYSNSSTFCT-SL---------------
---------FSSSSMETEPCRQ---LG-------TLPF--LPHPPKCEQQVSAG------
--------------------------------------HSSSSSLLVPGGDGDIGNA---
-HDEPEQSDDLKDFLNLSGGDASDGS--------------FHGENNAMA---FAEQMEFQ
FLSEQLGIAITDNEE-SPRLDDIYG------TPPQLSSLPVSSCSNQSVQ-----KA-GS
PVK---VQLSS-PRSSSGSATTNKARLRWTLELHERFVEAVNKLDGPE---------KAT
PKGVLKLMKVEGLTIYHVKSHLQ--------KYRLAKYLPETKEDKKASSE---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------DKKSQSGSSG----N
DS----------------------------------------------------------
--------------------------------------------------VKKKNLQV--
AEALRMQMEVQKQLHEQ----LEVQRQ---------------------L-QLR-------
----------IEEHARYLQRILEEQH-------------KVSISSNSLSL-KPPAES---
---QPESPKPTSEK-----KEAESEAGAATS-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------AQPSSEDKSPDA
ECKSSPPV----------------------------------------------------
---------------------GSKRARVHV-GDEHQC---------S
>gi|125538015|gb|EAY84410.1|	   467 residues, 50 /line  hypothetical protein OsI_005643 [Oryza sativa (indica cultivar-group)]
------------MSTQ--SVIA--VKQFSGPDKIA-------------------------
-----------QAYTVPQPSAHVLSNANYDY-DLCGSTNS-TSLS---------------
------------------CAIQSSNIKTESISSSSLPKILPF------------STDS--
---------------NGESSLSRMSQAEFSDPILSSSSTFCT-SL---------------
---------YTSSPMNSGSCRK---TG-------YLPF--LPQPPKCEQQQNSV------
-------------------------------------GQSSSSLMLL---DADLRNS--G
HADDEHT-DDLKDFLNLS----SDCS--------------FHGKCSAMA---YNEQMEFQ
FLSEQLGIAISNNEE-SPRLDDIYD------RPPQLMSLPVSSCSDQEDL-----QDARS
PAK---VQLSS-SRSSSGTASCNKPRLRWTPELHERFVDAVNKLEGPE---------KAT
PKGVLKLMKVEGLTIYHIKSHLQ--------KYRLAKYLPETKEDKK--QE---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------EKKTKSVANG----N
DH----------------------------------------------------------
--------------------------------------------------AKKKSAQM--
AEALRMQMEVQKQLHEQ----LEVQRQ---------------------L-QLR-------
----------IEEHARYLQKILEEQQ-------------KARESISSMTS-TTEGES---
---PEFAPMEKTED------------KAETS-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------SAPLSKCRITDT
DAECHSKV----------------------------------------------------
---------------------DNKKTKPQA-DLEMVHD--------E
>gi|115479007|ref|NP_001063097.1|	   533 residues, 50 /line  Os09g0395300 [Oryza sativa (japonica cultivar-group)]
-------------------MAM--VRELELMTSWS-------------------------
-----------NSMGRHRYPTRILVD-SFGH-KCSASDKGV-WTS---------------
------------------CSIRAPLQGRGSFRRGANIR-----------------FGS--
---------------LPSSAAVATSGGGRGGGGVVVGGGGGD-PW------------RRL
DGSTASTELSLSPPPAQAAGGG---GGGGGAD--ALPW--RHRPSPPSSAVATT------
SAAAAAALMAPMMLQPLDAGGGASAPPPPIRGIPIYNGPGGFPFLQPSPTAGDVGHH---
-HHHHPKMGFYSSYHHPSTWPSTSPS------PLAAPPGAASSPLDPTA--AFLSSPHHR
MLSAASGRL-NGMLS-VSDTLRSYG------VPGAAAPGVIGGAHHHHHH----LH--GG
QPFVGALASRF-MPKLPAKRSMRAPRMRWTSTLHARFVHAVELLGGHE---------RAT
PKSVLELMDVKDLTLAHVKSHLQ--------MYRTVKSTDKPAASSGPADG---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------GSGDEEFAGG----G
QAASGGGDSM-----------------------------CLRGGGGGGVA----------
------------------------------------------------------------
--------------------------------------------------AAA-------
----------FAEHGRSASEGAASSV-------------G-----G--------------
------------------------------G-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------GGGDMDQSSAGN
TSTTRWSNSSRDPWLSSNSCNMDAHRSVGLSSPIEVLALPL-------------------
-----ASLIMSD-TAYLFFSSNHGRCEPAS-LDQKLAD--------I
>gi|31415919|gb|AAP50940.1|	   432 residues, 50 /line  hypothetical protein [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------ML
QRNLPNLSLRISPPAVSSAA----------------------------------------
------------------------------------------------------------
-----------------------APV------SSGTPTTAARTTL-PTG--VITDAEGGG
EVAAFFGNP-SSGSE-PPGLSLGLG-------PTTPAHADAGGGRHGDHH----LQPQGC
APFKRAAARAS-QLPAGSKRSVRAPRMRWTTALHARFVHAVELLGGHE---------RAT
PKSVLELMNVKDLTLAHVKSHLQ--------MYRTVKSTDRSSHIASGEAQ---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------LQQQAGMEVA----M
EAAAGGGGNG--------------------------------GGGGGGVVLPMMPACDDM
VGICSSPAPPAAATSSAAAYFLCATTTS-------------------TATAPLAVVPS--
PPAPTIPTRFHECIYGD----VDVVIQSISML----INVLLHGIDKSCL-ALT-------
----------FLEHRRTDQTPALEKG-------------V-----AIVDS-LHRCQK---
---HNYSPVLQ----------------DALH-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------QGAEEDHLITGN
LPMGGASAQASIEAMATTNSSSPASSSPSLASLEQLLP----------------------
-----EDSFAPN-LEISLGRHNWNMDHPEE-LSLKYL----------
>gi|125524640|gb|EAY72754.1|	   433 residues, 50 /line  hypothetical protein OsI_000601 [Oryza sativa (indica cultivar-group)]
------------MASS--SSDL--------------------------------------
--------------------------------TLDDHHHLTAVAA---------------
------------------ASGQATQKLQEF------------------------------
--------------------LSRLEEERLKIDAFKRELPLCM-QL---------------
---------LNHAMEAYRQQLE---AY----------------QMGSQHGAAAA------
--------------------------------------AAARAPLVL---EEFIPVK--N
IGIDVVAAD--KAAAAAAGGN------------------------------SVSSEKASW
MLALAPAEKAADAIT-IAAGEVDKK------PYAHD---NGVVARSREAQ----N--GGK
PPS---TPPDG-QAVPPPPQPHRKARRCWSPELHRRFVNALQILGGAQ---------VAT
PKQIRELMKVDGLTNDEVKSHLQ--------KYRLHTRRPMPSPAPP--TA---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------ATPQLVVLGGIWVPP
EYATQAAGPA--------------------------------IYGAHPATQPHYTA----
------------------------------------------------------------
---AVAAQEYYHHHHHH----LQHHPA---------------------A-AAL-------
----------VHHRAVAPPPPLPPQQ-------------QLAPP----------------
----------YSAK-----SSASARLGSPDS-----------------------------
---------------------------------------------------------DGR
GS---GGGGGAAASG---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------AGRDMSESIEEE
GEGEEREDDDDDDEMAATN---NAHAVDGDDD----------------------------
-----DDEINTT-TTTSAGAI----------------N--------Y
>gi|125538238|gb|EAY84633.1|	   576 residues, 50 /line  hypothetical protein OsI_005866 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------MRWPEELHRRFVHAVRRLGGCH---------EAT
PKRIMQLMGAKGVSISHVKSHLQ--------MYRNSNNSSNVNRRHPVTPQIDWTTTAQQ
DEQQRRQMSSFSFLATRTVPAAGIGSHSHQRPHRRQALHAGDDDGCELTLSISGGA----
-------------AEESKDGGS---SITDDDDELLIQPPAP---NIINDDGSTRHGSHCC
LLLGYIVFKLLVSQFDTAALLVRFWMGICVMDRSDLST----------------------
------------------------------------------------------------
----------------------------------GNSAHASLLLRSASVA--FLFTAPYG
GDHGVGADAATTASIPSFSPGAARRFAADHGLAVHAVALRVADAADAFRASVAAGARPAF
QPADLGGGFGLAEVELYGDVVLRFVSHPDG-ADAPFLP-GFEGVSNPGAVDYGLRRFDHV
VGNVPELAPVAAYISGFTGFHEFAEFTAEDVGTAESGLNSVVLANNAETVLLPLNEPV--
HGTKRRSQIQTYLDHHGGPGVQHIALASDDVL----GTLREMRARSAMG-GFEFLAP---
-----PPPNYYDGVRRRAGDVLSEEQINECQELGVLVDRDDQGVLLQIFT-KPVGDR---
---PTF-------F-----LEMIQRIGCMEK-----------------------------
---------------------------------------------------------DES
GQEYQKGGCGGFGKG---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------NFSE--------
------------------------------------------------------------
-------------LFKSIEEY--EKSLEAK-QAPTVQG--------S
>gi|125555658|gb|EAZ01264.1|	   513 residues, 50 /line  hypothetical protein OsI_022496 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------MVLDLNEGFGEGSEE---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------GGVGEDGDE---
-EDDDEDDDDDDDDDGGSTSEVAG------------------------------------
----------------------GGR------SSSNNSSTNHNSGSDKDHD----M-NSSS
SKADG---GGDRVPTVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE---------RAT
PKLVLQMMNVRGLSIAHVKSHLQ--------MYRSKKLDHESGHERGAISSV--------
------------FSPMEFHMRRGDHRFHHHDMFFQRAAAAGVSPFSSRMLHENGGG----
-------------FFASRNPG------LPESSRLY-------------------------
-----------------GLFQRRQQ---APMQKFDFKN----------------------
------------------------------------------------------------
------------------------------------------------------------
----------CDSFSRNQEWAFNQQHAAARAAGAVNGHGPA-------------------
------------------------------------------------------KGLIHE
MIFQKEGKPTSHLFDVRDAIASTRVTSATTAAAADHRLDGAGKAGNFDWIGSSSSRPL--
T-----------------------------------------------------------
-------RTMSAA-----------------------------------------------
----------TAAT-----MGDHHHLRW--------------------------------
------------------------------------------------------------
------RGGAAGSGNTTASSDPVVASEAALGSLLERAKTK---------------ATE--
------------------------------------------------------------
----A--MRLETPVKMTAAAV-------------------------AAEEINSRTPDLQL
S-----------------------------------LSPNAGDHRS--AGKKRKFLS---
-------------EQEVDSDKQQLPLTLSLSLRGGGDNGGGGG--------------GG-
-----EAAGRLE-EEM-TGSSSSKKAALGL-STLDLTM---SIKALE
>gi|50251518|dbj|BAD28879.1|	   545 residues, 50 /line  myb family transcription factor-like [Oryza sativa (japonica cultivar-group)]
------------MKEK--EVLVEIVEDDELKRSIG-------------------------
-----------RNQLDLNEEVMDVESE---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------EGEVGDD---
-EDDEDEEDDDDDDDGGSTTDVAG------------------------------------
-----------------------SR------SSSNNSSTNNVSESKLKGD----K-DSGG
GRLEGINGGEQRVPSVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE---------RAT
PKLVLQMMNVRGLSIAHVKSHLQ--------MYRSKKLDHEGRQIRGAIASV--------
------------FSPMDFHLMRGDRRF--HDMLLQRAAALS----SSRQEH---GG----
-------------FFSSRSGGGGG-GLPPEASRLY-------------------------
-----------------GLLQHRQSPAIATMQTLDFKN----------------------
------------------------------------------------------------
------------------------------------------------------------
------------SSFRNQEWSFSFNHQRKETM------NPS-------------------
------------------------------------------------------SSSSTT
AAI-----------------RRWPSAAGAVAVVAGERQRLAERFGYYTGNGGASSTSL--
P----------------------------------------------LI-TRAAMAA---
-----PPPMFAAA-----------------------------------------------
----------VAPP-----GRDHHRLPFGWH-----------------------------
---------------------------------------------------------A--
-----GGGGGGGGNKNRSSSDPVVIDEALDSRRLEH-QQK---------------HVE--
------------------------------------------------------------
----Q--PRMTPTTTTTPA---------------------------GKRPPEWSPPDLQL
T-----------------------------------LSPTTAPAAADGGGAKRSKTSTTT
TNTTAAISGEQEAEKNMDRCKNKLSISLSLSPPAAAAAAANFSS----------MDLSM-
-----EQQKQKQ-EKTTIGSSEEEAGDLGQ-STLDLTM---SIRALE
>gi|125561650|gb|EAZ07098.1|	   482 residues, 50 /line  hypothetical protein OsI_028330 [Oryza sativa (indica cultivar-group)]
------------MSSQ--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------QQQQHA-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------GEAPASAAAAARARLRWTGQLHERFVLAVAELGGAD---------RAT
PKSVLRAMAVPGLTLYHLKSHLQ--------KYRQAVSRGGNGGG---------------
------------------------------------------------------------
--------------------GGSG-SLNDRSSSSERQPADH-------DGDSAAD-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------EPRTIAYDGDSDG--
------------------------------------------------------------
--------------------------------------------------DAKEALRDSS
RSMVQMQREVQRKLQEQ----IEVKRH---------------------L-QLR-------
----------MEAQGRYLQSVLRRAQ-------------QVL-ADHSLAS-SPEAAT---
---TELSELASAVD-----IECMSSSSPPRHHRQSAATDSCVTTTSSSEAESKAAGSKRL
HT---------SDCTVEQPVQGKRT------------FNFLQRHTQAD--------QEEE
QEEEYAGAEDG-SSSEIDLNRKYITPMSSLSLRQYLTYLL---------------FIPSR
QREYPLMG-----TFCSMKEQA-------------SSGNAKSRLGVL--------ILVKF
L---Q--CKLTSTGVSSQL---------------------------EAICLENLPALARL
ELPSD-------------------------------ADADADADAAARIHRFHGRPVLPS
AGLRNRPWTPAAALAGVDELTSGLGLGLGRGRA-AGVAGGGFGG----------------
-----------R-PEVGGGEHGDPRGGGAV-LRTRFCW--------A
>gi|125584792|gb|EAZ25456.1|	   426 residues, 50 /line  hypothetical protein OsJ_008939 [Oryza sativa (japonica cultivar-group)]
------------MATA--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------DEVGG---GGGGG------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------GAG---VG----------------------------
-----------------------------------------------------------A
GDQVRRAKTAALF------------------------LAAVALPCLVL------------
--------------------------------------------------YRAAVSPAGL
FLRP-------------------AALPGPPRGDVDPVN----------------------
------------------------------------------------------------
----------------------------------SEDARLERVLRAAAMANGTVILTTLN
S-AWAEPGSVVDVFLESFRIGDETRWLLDHLVMVSLDLTAHRRCLQIHRHCFA-------
------------------------LTTDDG-FD---FS-GEKNFMTDGYLKMMWRRID-F
LGHV--LAKGYSFIFTDTDIVWFRNPLPHLHHDGDFQIACDHFTGDPDDLSNSPNGGF--
AYVRSTSATAAFYRYWYAARERHPGLHDQDVL----NLIKRDAYVARLGVRIRFLST---
-----DLFAGLCEHGRNLSTVCT---MHANCCVGLRRKVDDLGLMLQDWR-RF-------
----------MATP-----GSDRHSVTW--------------------------------
------------------------------------------------------------
------SVPRNCSMKKLG------------------------------------------
-RLEPTLA-----VVCTIDEML-------------TGTNEHAVLSKL-------------
------------------------------------------------------------
----------------------------------------------------------GS
DSTNLVKTWSRMTE-----------------------------M----------LRVWC-
---------------------NNRKVSPTA-ADADAMD--------D
>gi|23306127|gb|AAN17394.1|	   517 residues, 50 /line  Putataive InsB from Escherichia coli [Oryza sativa (japonica cultivar-group)]
------------MATAVHLHRFSTRPH---------------------------------
----------------------YGRWPQHDF-TSLKKLRPQS------------------
----------------------------------VTSRIQPGS---------DVIVCA--
---------------EM-------------------------------------------
-----------------DEQWG---YVGAK------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------SRQRWLFY----------------------------
-----------------------------------------------------------A
YDSLRKTVVAHVF--------------GERTMATLGRLMSLLSPFDVVIWMTDGWP----
-------------LYESRLKGKL---------------------HVISKRYTQRIERHNL
NLRQHL------------ARLGRKSLSFSKSVELHDKN----------------------
------------------------------------------------------------
----------------------------------SEDARLERVLRAAAMANGTVILTTLN
S-AWAEPGSVVDVFLESFRIGDETRWLLDHLVMVSLDLTAHRRCLQIHRHCFA-------
------------------------LTTDDG-FD---FS-GEKNFMTDGYLKMMWRRID-F
LGHV--LAKGYSFIFTDTDIVWFRNPLPHLHHDGDFQIACDHFTGDPDDLSNSPNGGF--
AYVRSTSATAAFYRYWYAARERHPGLHDQDVL----NLIKRDAYVARLGVRIRFLST---
-----DLFAGLCEHGRNLSTVCT---MHANCCVGLRRKVDDLGLMLQDWR-RF-------
----------MATP-----GSDRHSVTW--------------------------------
------------------------------------------------------------
------SVPRNCSMKKLG------------------------------------------
-RLEPTLA-----VVCTIDEML-------------TGTNEHAVLSKL-------------
------------------------------------------------------------
----------------------------------------------------------GS
DSTNLVKTWSRMTE-----------------------------M----------LRVWC-
---------------------NNRKVSPTA-ADADAMD--------D
>gi|125591971|gb|EAZ32321.1|	   552 residues, 50 /line  hypothetical protein OsJ_015804 [Oryza sativa (japonica cultivar-group)]
-MRRSGAPPQENYSES---RVRLVQINLAYSAFIP----TDWN-----------------
-----------NLETAESRPKSTGLNKVRAF-E-EPMRRACSAAP---------------
------------------SGFQKTSLRIPSPSTHEAPTGAQQK---------TRKLKPGA
ENNQSYPVGVRLYKLELETKKNQISKENDSEDIMNTKKIKLH-DCHFGSPLCDPSPAPHL
LSSAAAAGLSFHPGLVSSAAQHQQHGAGGWLHEEYYAP--RSSPPSSLLAQTCV---GSN
ATAFYAAENLPQFDFPALGTAAAAAAKAPFRSSESELYRPVDPLLLRADHS---------
-----------------------VRT------YYVRPQKRDSGERTPLP---PPSQQQHQ
DRIHGLFAGAPTTRL-LSGEPKIHS------FPPQVAAKPILPAMDAPSLQNQMENQLTR
NCIGAATPVTP-TGNLAGSGAPSKTRIRWTQDLHERFVDCVNQLGGAD---------KAT
PKGILKLMNSDGLTIYHIKSHLQ--------KYRIAKYMPASSEGKQLE-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------KRATGNDM------Q
NL----------------------------------------------------------
--------------------------------------------------DPKTGMQI--
TEALRVQLDVQRRLHEQ----LEIQRN---------------------L-QLR-------
----------IEEQGKRLQKMFEDQL-------------KASRSVM-----EPQELD---
---D------------------------------VVAFAAGDGDDDAF------------
------------------------------------------------------------
-------------------DDVDVQLLAVAGS----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------GYDDAG-----------FQSKIS
>gi|125600041|gb|EAZ39617.1|	   507 residues, 50 /line  hypothetical protein OsJ_023100 [Oryza sativa (japonica cultivar-group)]
-------------------MAVMRSYWSLSHLTSP----AMVDKGGRPTTAL---NGGVV
GDVFLGSEAPVVTSSISKYAGLVFGGAHRDV-SALGEEKLS-FFG---------------
------------------KSSQQKRISTNQLYNSGIPVTVPS---------------PLP
AIPATLDENIPRIP-DGQNVPRERELRSTPMPPHQNQSTVAPLHGHFQSSTGSVGPL---
---------------RSSQAIRFSSVSSNEQYTNANPY--NSQPPSSGSSSTLN---YGS
QYGGFEPSLTD-----------------------------------------FPRDA---
---GPTWCPDPVDGLLGYTDDVPAGN-----------NLTENSSIAAGD--ELAKQSEWW
NDFMNYDWKDIDNTA-CTETQPQV-----------GPAAQSSVAVHQSAA-----QQSVS
SQSGEPSAVAIPSPSGASNTSNSKTRMRWTPELHERFVDAVNLLGGSE---------KAT
PKGVLKLMKADNLTIYHVKSHLQ--------KYRTARYRPELSEGSSEK-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------KAASKEDI------P
SID---------------------------------------------------------
--------------------------------------------------LKGGNFDL--
TEALRLQLELQKRLHEQ----LEIQRS---------------------L-QLR-------
----------IEEQGKCLQMMLEQQC-------------IPGTDKAVDAS-TSAEGT---
---KPSSDLPES------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------SAVKDVPENSQNGIAKQ-TGMRI----------H
>gi|125604113|gb|EAZ43438.1|	   477 residues, 50 /line  hypothetical protein OsJ_026921 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MDDRTVIMTSIN
R-AYAAPGSLLDLFLESFRLGEGTEPLLKHVLIVAMDPAAVAPVPPVHPHCYL-------
------------------------LRRPEGAVD---YS-DEKR-VSGGTASGKTTVCD--
--MIIQQLHDHRVVLVNQDS--FYRGLTEEESDRVQDYNFDHPDAFDTEQLLECMGQL--
KSGLSVNIPIYDFKNHRRCSESFRKVNASDVIILEGILVFHDQRVRDLMDMKIFVDTDAD
IRLARRIRRDTVERGRDVISVLEQ---YGRF---VKPAFDDFVLPSKKYA-DV-------
----------IIPR-----GGDNH------------------------------------
-----------------VAID---------------------------------------
--LIVQHIRTKLGQHDLC------------------------------------------
-KIYPNVY-----VVNTTFQVV-------EHGLGHLPFTEKQIVTPTGSTYMGVDFCKKL
CGVSI--IRSGESMENALRACC-------KGIKIGKILIHRD----GDNGQQLIYHKFPL
DIAERHV---------------------------LLMDPVLGTGSVEFIQCSFHSDVCLL
VGMRTTEVTAKVSYHNYSTVQAPEGVHCVCKRFPRL------------------------
------KIVTSE-IETGLNEEYRVIPGLGEYGDRYFGT--------D
>gi|145338102|ref|NP_187095.2|	   442 residues, 50 /line  transcription factor [Arabidopsis thaliana]
-------------------MTL--ASDFGFPSAI--------------------------
----------SSSFTILEE-----------------------------------------
------------------------------RYHNNFP-----N---------TLCVSSGQ
ESMNNNPVP--------CQVFPLVSGGSSGGNLFSSSSGFCN-GV---------------
---------YVSSSSQARP---------------SVST--VPRDRITVAHVSGE------
---------------------------------------GQRQECPVETHSLQLINQPQE
QKIMTWSSDQIRGFFDFPVPDPQAAS--------------SRTMVSSK---EVLSKCEWP
DWADQ---LISDDSL-EPNWSELLGDPNVLNLYSKIETQSSDIARQEIVFR----NQHQV
DPS---MEPFN-AKSPPASSMTSKQRMRWTPELHEAFVEAINQLGGSE---------RAT
PKAVLKLINSPGLTVYHVKSHLQ--------KYRTARYKPELSKDTEEPLVK--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------NLKTIEDI------K
SL----------------------------------------------------------
--------------------------------------------------DLKTSIEI--
TEALRLQMKVQKQLHEQ----LEIQRS---------------------L-QLQ-------
----------IEEQGRYLQMMIEKQQ-------------KMQENKKDSTSSSSMPEA---
---DPSAPSPNLSQPF---LHKATNSEPSITQKLQNGSSTMDQSESTSGT----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------SNRKRVRE--------D
>gi|147766771|emb|CAN69684.1|	   451 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------MDNL--KKVM--QTHYSVXSRV--------------------------
----------PNFLGAESV---------GEY-SLYGKESPA-GIP---------------
------------------PCIQREQV-LNSLAQLXLFKHHI-------------------
--LNTSPVS--------XKPFPMGSYVMNPHDMSTQPSMFPA-AL---------------
---------YSPSSTRFETHQH---LG-------NPHF--LPQYPPC---VSPA------
--------------------------------------NSSESPLLL---GDDVADK---
-YDKENSEDLMKDFFGIPE-ESSDQS-----------LQGLDAEKDSLT---LMDLLDLR
YLSEELDI------------PEICQAPNVSS------------------------IPPQS
HPHALVPPMDNQ---VPEAAAAQKQRIRWTPELHELFLDAVSKLGGPD---------KAT
PKGILRLMNVEGLNICHVKSHLQ--------KYRLAKAVQ-MKQDKKASSSE--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------ERKVATKTDE------R
ET----------------------------------------------------------
--------------------------------------------------PIERAMQV--
TETLRVQVEVQKILHEQ----LKLQKV---------------------L-QLN-------
----------LEQNGEYLRRILEDQH-------------KAGVALPSLMGSHSNPQP---
---IPLSSSDGASSPKQYDFEVDCFPSLLSKHKASHTTESEQPR---CHKKPRRSSSVEI
IC---------IDSPAE-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------SVEG
>gi|147768905|emb|CAN75879.1|	   523 residues, 50 /line  hypothetical protein [Vitis vinifera]
-MNTKKIDVVQN-------------QNTGSFNCYS--GKGIFSRQPWKMGF---------
------------------------------------------------------------
------------------------------------------------------CFQPDQ
LPASEGGST---------------------QQIINLGSTPTTIAGHFGCPA---------
------------------------------------------------------------
ASAFYATEF--YMGFPECDSYPADSVTSSYPSSKFD---------PAGSQSKDTQNLPSC
ENQN------------------------------------STRTPYRNS--QVCDILFI-
-------------------------KSDVEDAQPYRILR-----------ENQNQRIEPS
SRFQLRRQPAN-PSHNTTSFASNKTRIRWTQDLHKRFVESVNCLGGAE---------KAT
PKGILKLMGSEGLTIFHVKSHLQRSAIIVFQKYRIARHQPGSTEENSE------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------KRTCADVI------T
KF----------------------------------------------------------
--------------------------------------------------DPETGLRI--
AEGLRLQLEVQRHLHEQ----LE-------------------------------------
------------HSAQNDKKL------------------------NSLKGGKP-------
---GNSCPRPAHR-------------------VRSRRDQARLVICQADEGEADKNAVEFI
ALNNTDWPFSNYELQIGQAVDKSALIHVR--PLLLGSSVFFYLFFWLA------------
--------------------------ICHRPRFPTWWHVC---------------VATTL
GKNQGTRSSLKQPPMASRRYQA-------------EEIDQFSRLLKM-------------
-------------------------------MRRQAG-----------------------
----------------------------------------------------------GN
LIMNDIKRLERLERLV---------------------------M----------VAIWCI
QEDPALRPAMKK-VILTLEGVVEVFVPPRP-LGIFVGS--------S
>gi|147841484|emb|CAN64238.1|	   503 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------MNHH--SVLS--AKQTESTKGFT-------------------------
-----------QSYCAAVSPIHNLLNVELEGQNSFKSDCSS-SHS---------------
------------------RFTQTELPGPANFMQASVVQP---Q---------KLCSKS--
---------------GPYSSVSSDTDAQYPKCTFSRSSVFCT-SL---------------
---------YLSSSSSTETHRP----------LGNLPF--LPHPSMSYQSISAV------
--------------------------------------HSTKTPFL----SGDSSGL---
-YDEGNSEDMMKGFLNLSS-DASDES-----------FHVMNCASDNIT---FSEQLELQ
FLSDELDIAIADNGE-NPRLDEIYEMPQ-------DSSTPAMALGLTVNQ-----NHQSV
APS---ADASS-GQPSPGAAAAHKPRMRWTPELHERFLEAVNKLEGAESLPILLWNVEAT
PKGVLKLMNIEGLTIYHVKSHLQ--------KYRLAKYMPERKEDKKASGSE--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------EKKAASSNNE------S
DG----------------------------------------------------------
--------------------------------------------------RRKGNIQI--
TEALRLQMEVQKQLHEQ----LEVQRT---------------------L-QLR-------
----------IEEHARYLHKILEEQQ-------------KAGSALISPPSLSSPTNPHPD
SERQPSSPSATTTLPQPAECKADSSSPPPSKHKAATE--TTDSEQQACSKRSRLESNPES
VS---------DEA----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------V
VENPS-----------------------------------------Q
>gi|147866379|emb|CAN79854.1|	   438 residues, 50 /line  hypothetical protein [Vitis vinifera]
-MARKPXTG---------------XKMEMQGSGRTAGGLEGQDGAGRAWRGV---GSGRN
MPHAPPRAGAWRSPPGAPSGMVGVVKIG-RAESSPESSPESSPENFAGGEWFLATIRLTG
KYWEMGKVTGKKHGDRKETRSPEVLPTPLEEKYPKLPNSFQV---------------SAE
VKMMTNPIS--------PQAHQLASNNGTVGYMLSSDFVFPK-DT---------------
---------NLSSFSSNSS------------GSQNSLF--IPQSSTNGVSLPPI------
--------------------------------------SSSGI----EIQSTPSVTFSRE
RKENSWCTDSLKDFLDFPE-NVPIQN-----------NNQVEGSGGGMSYEDCAKTTDW-
--PDWADQFLNDDDSLEPNWNGLLIDVDVPDPESKVLKPSSSVLTHQSEI-----CQHHP
AQS---GEISA-VPNSLSPAPSSKPRMRWTPEMHEAFVEAVKQLGGSE---------RAT
PKGILKLMNVEGLTIYHVKSHLQ--------V--LAEHPMQVSPGKI-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------YILLSSMTPL----------VTMRFK
QRLWT---------------------------------------TAF
>gi|15235236|ref|NP_193730.1|	   715 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MKSTNDESPSLG---------------------YDFAGVSIKDGKSKPPAPVICYDGLFG
GRDVIRIVLLVTTVTLS--------------CLLFYKSANNPLNMVFSPWKTDCYASKLT
NESSSKTEPKKEPV-------------------SELERVLMNAAMEDNTVIITALNQAWA
EPNSTFDVFRESFKVGIETER---------------------------------------
-------------------------------LLKHVIA--VCL-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------DIKAYDQCLKVHPHCYLINATDSDQLSGPN---------RFM
TPGYLKLIWRRMDLLRQVIG----------------------------------------
------LGYNFIFTDADILWLRDPFPRFFPDADFQITCDDYNGRPSDKKNHVNSGF----
-------------TYVKANNKTSK-FYKYWIRSSRKFPGKH---------------DQDV
FNFIKNDLHVEKLGIKMRFFDTVYFGGFCQPSR-DINVVNTMHANCCIGLDNKVNNLKAA
LEDWKRYVSLNTTVSETKWNIPPSFLDYGSAIGQKEVKKILVLVLGLAACLLLYKTAYPL
HQELDVNNLSSR--PLLDHTSSSSPLT------RSKSISFREVLENASTENRTVIVTTLN
Q-AWAEPNSLFDLFLESFRIGQGTKKLLQHVVVVCLDSKAFARCSQLHPNCYY-------
------------------------LKTT-G-TD---FS-GEKLFATPDYLKMMWRRIE-L
LTQV--LEMGYNFIFTDADIMWLRDPFPRLYPDGDFQMACDRFFGDPHDSDNWVNGGF--
TYVKSNHRSIEFYKFWYNSRLDYPKMHDQDVF----NQIKHKALVSEIGIQMRFFDT---
-----VYFGGFCQTSRDINLVCT---MHANCCVGLAKKLHDLNLVLDDWRNYLSLSE---
------------------------------------------------------------
-----------------------------------------------------------P
VKNTTWSVPMKCT-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|15795136|dbj|BAB02514.1|	   554 residues, 50 /line  transfactor-like protein [Arabidopsis thaliana]
MYIKAI----------MNRHRLLSAATDECNKKLG-------------------------
-----------QACSSSLSPVHNFLNVQPEHR----------------------------
--------------------------KTPFIRSQSPDSP---------------------
---------------------GQLWPKNSSQSTFSRSSTFCT-NL---------------
---------YLSSSSTSETQKH---LG------NSLPF--LPDPSSYTHSASGV------
--------------------------------------ESARSPSIF---TEDLGNQ---
-CDGGNSGSLLKDFLNLSGDACSDGD-----------FHDFGCSNDSYCLS---DQMELQ
FLSDELELAITDRAE-TPRLDEIYETP--------LASNPVTRLSPSQSC-------VPG
AMS---VDVVS-SHPSPGSAANQKSRMRWTPELHESFVKAVIKLEGPE---------KAT
PKAVKKLMNVEGLTIYHVKSHLQ--------KYRLAKYMPEKKEEKRTDNSE--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------EKKLALSKSE------A
DE----------------------------------------------------------
--------------------------------------------------KKKGAIQL--
TEALRMQMEVQKQLHEQ----LEVQRV---------------------L-QLR-------
----------IEEHAKYLEKMLEEQR-------------KTGRWISSSSQT----VLSPS
DDSIPDSQNMSKT-----KASSPQPPLPAENKASE----TEDDKCESPQKRRRLENIAES
---EDPKRSLSETCKLITDIEDVTAFTVRKESLILCLCVYRSLTFMHTITYGKQNNLSKI
LHSHQSSLSLSLGKVKI-------------------------------------------
---------------------------------------KGFVVALTGLDSLGGVFCKKV
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------VCFDLLCYN---GENFSE
>gi|2244955|emb|CAB10376.1|	   441 residues, 50 /line  regulatory protein [Arabidopsis thaliana]
-MAQMLLRGSMS----------------------RVAGRCRSEFGDLPN-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------CGDDKDIHNAVNGGF--
AFVKANQRTIDFYNYWYMSRLRYPDRHDQDVL----DQIKGGGYPAKIGLKMRFLDT---
-----KYFGGFCEPSRDLDKVCT---MHANCCVGLENKIKDLRQVIVDWENY--------
----------VSAAK----TTDGQIM----------------------------------
------------------------------------------------------------
----TWRDPENC-MKQWWWRNKTKQVLSENSKENYLNIMLFIKTYIILNFCLPMNNIRNK
IMLTTTIL-----ILLIVILMVSLHLYYRWYLLRSSPFNRTTAASTFFTDPSSTPGGLNP
SIIKSLPIFTFSAVTALFAMECSVCLSEFKDNESGRVMPNCKHTFHVHCIDMWFHSHSSC
PLCRSQIEPFAGGVKSS-----------MDEVAISISDPVYGDTNHHEGTETTGDSVP--
EDSQRKPAAIEISQRNLGEIENDLSRSHSFRSPT--------------------------
--DEPDDIFHSE-FESRSGEVLLLLLLLSEFLIFCFRR---SVAC-K
>gi|5916207|gb|AAD55941.1|AF174532_1	   752 residues, 50 /line  regulatory protein of P-starvation acclimation response Psr1 [Chlamydomonas reinhardtii]
------------------------MDKAERAAGGP-------------------------
------------------------------------------------------------
----------------------------------------------NAASEDDWLLEFWP
EPAADFPAPV-------------APMLSQHQDAAQLPEAMPQ---------------QQG
LALGGYGLTQQPSDFMQTGMPGFDAFSSGKAATLGLPL--LADPQRA-------------
------------------------------------------------------------
------STDGASALMNAAQQSSEYM------------LAPGMGGMPHL------------
-LAPSVGTALPGTGH-TGFADLSM--------------------------GGMAG-GIPG
LGGPGIMHGQYFMQPQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPD---------KAT
PKGILKLMGVDGLTIYHIKSHLQ--------KYRLNIRLPGESGLAGDSAD---------
--------------GSDGERSDGEGGVRRATSLERADTMSGMAGGAAAALGRAGGTPGGA
LISPGLAGGTSSTGGMAAGGGGGG-GLVTEPSISRGTVLNAA------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------GAVATAA--PAAAAPAG
GSA----------------------------------------AVKRPAGTSLSS----G
ST----------------------------------------------------------
--------------------------------------------------ASATRRNL--
EEALLFQMELQKKLHEQ----LETQRQ---------------------L-QLS-------
----------LEAHGRYIASLMEQEG-------------LTSR-LPELSGG----APAAA
PVAAGGAAGGMIAPPPPQQ--------QLQHQPQLLQPQGSLPAGGSSEAHAAAGAGTMV
VHQQQQQHVHHHHQQQ-----------------------------------QVQMQQHAR
HCDTCGAGGAGGAPSGGSSMQQLQAAEQQRTELVVAGRLGSMPA----------------
------------------------------------------------------------
------------------PASSSPLAGQAHQQQPLAGGAAHLVHVHSH--------TPGG
QPHVQHQDAFAGAATAAAHASPGLPQSHSHLLPA-DLSSNAGPDTSAGQIKPEPDMS---
---------QQQQQQEQQEAEQLAQGLLNDSSAGAGAVSGSDGGGLGDFDFGDFGDLDGG
AQGGLLGPGDLIGIAELEAAAAHEQQQEQE-HDPLDADRAKRQRVEP
>gi|6942190|gb|AAF32350.1|AF219972_1	   470 residues, 50 /line  CDPK substrate protein 1; CSP1 [Mesembryanthemum crystallinum]
-MNMRPALPMQT------------------------------------------------
-------------SGGNCF----------------------------------NELKVSG
PYSSQLPVLPNPLEDFP-----------------KSPDPFAV---------------SSS
REMIPNPLQ--------IQANPMVSHFGSSHNSSTYASGFPT-DL---------------
---------HFPSFSPRERQSQNSPLGGG------VAF--PPSQNTS-------------
----------------------------------------------PDVQSAGFINYQKE
DDDNSWSTGHLQDLLDFPE-GIPVSN------------GQVGTSTEVMSNDNHVKRIGW-
--RELTEDLYADS--IEPNWNDFLADSNVADQQPKVTQPSSDVRVHQPLIQQQL-SLPPR
EVSAAANQTSA-AANQTSAAHSNRPRMRWTPELHEAFVDAVNQLGGSE---------RAT
PKGVLRHMNVEGLTIYHVKSHLQ--------KYRTARVRPESSEGNSER-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------RASSVDPV------S
SV----------------------------------------------------------
--------------------------------------------------DLKTSVTI--
TEALRMQMEVQKQLHEQ----LEIQRK---------------------L-QLQ-------
----------IEEQGKYLLQMLENQN-------------KVEKEKLNPDGSSAHNDKSEG
SQPEPSREGAVIS--ISSQGPGESSHGSKGKQKAPEADTTGD------------------
---------------------------------------------HHLEDGGSNPPP---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MKRARTDD------SFL
>gi|92871144|gb|ABE80246.1|	   428 residues, 50 /line  Homeodomain-related [Medicago truncatula]
-MNMSDG---------------YEKQENERSTGKSEEHGEDTSMGSSSHNKCS-------
------------ISFDLNEEASRSDQD---------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------VNNEENDEAC----------------------------------------
--------------------------------------------------DHELVNN--G
DDDDEKLAKDDDEGSSSSTKRSSG------------------------------------
------------------------------------------------------------
-------SNERRRNGVRQYVRSKMPRLRWTPDLHHSFMHAVERLGGQE---------RAT
PKLVLQLMNVRGLSIAHVKSHLQ--------MYRSKKLD-EAGQVLSPTHRS--------
--------------------------------------------------------THEL
GSISHHVAHQSMIPHQHFKMANGGIVLET-------------------------------
--------------------------------------------NYNQHSYNFHSLLHPS
SLSHSH------------------------------------------------------
----------------------SHSHSKPINSRHQEWYLNHQSWRPSYMSNELVM-----
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------P
STTLNTQGRSSITLNQQ----LQVKDNTVTTT-------------------LAPMRPSQF
LEEKRWPPLDIMNNHPYWKKNLHDHF----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----SSDRTSLRPA----------------------------------------------
------------------------------------------------------------
-------EVSFGNNTRSRENISNINNDH-----------NYFNSSKIEFDPPFRIKLNQE
TLLKDKQWVPD--------------LQLSLSQTNGNNDGKSDGLRE--------------
----------------------------TKEIDTKLSL--------S
>gi|84778268|dbj|BAE73187.1|	   478 residues, 50 /line  KANADI-like transcription factor FEATHERED [Ipomoea nil]
-MPLEGVFI--------------------EPSSRS-------------------------
------------------------------------------------------------
----------NPLPDLS----------------------------LHISPPNNTISSSRP
SSCINELVAAAAG-------FDLPTNHRRHRQTDNNTSTSAAAA----------------
----VYPELSLANPTATAAEENRFLRTGREQQQQHQTLQTYPQPYHLQTHTFQQNNSNSN
NSSCSQMSNINHGVSLLDVSDGLR----PIKGIPVYQNRS--------------FPFLPM
DRENK--DPSKMCFYPMPPPPPPTASISHSPSPFFNPVVDHLSLL---------NNPSPS
SSSSSAAAAAAAYR----RFNGLSSAYQLPHNQYGGVGIGATAASHHHHH----HPHHDA
PPSHGMMMRSRFLPKLPAKRSMRAPRMRWTSTLHARFVHAVELLGGHE---------RAT
PKSVLELMDVKDLTLAHVKSHLQ--------MYRTVKTTDKPAASSGQS-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------DGSGEEDL---TVLG
STAAGGGGIRLMDQ----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------RGHPAAAVADGSSEPDFPNS---------TTTTLWSNSSSSR-----------
---------EAWLQTNSSQESNGLIRSSSFPTQQRCGHPID-------------------
-----DCEKNPS-LEFTLGRPDWVQKER------------------D

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.