FANDOM


>gi|22325422|ref|NP_178307.2|	   1146 residues, 50 /line  SOS1 (SALT OVERLY SENSITIVE 1); sodium:hydrogen antiporter [Arabidopsis thaliana]
--------------------------MTTVID---ATMAYR--------FLEEATD----
------------------------------------------------------------
------------------------------------------------------------
-SSSSSSS-SKLESSPVDAVLFVGMSLV-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIASRH
L--LRGTRVPYTVALLVIGIALGSL-EYGAKHN--LGKIGHGIRIWNEIDPEL-------
--------------LLAVFLPALLFESSFSMEVHQIKRCLGQMVLLAVPGVLISTACLGS
LVKV-------TFPYE---WDWKTSLLLGGLLSAT--DPVAVVALLKE-LGA-SKKLSTI
IEGESLMNDGTAIVVFQLFLKM--AM-----GQ-NS-----DWSSIIKFLLK---VALGA
VGIGLAFGIASVIWLKFIFNDTVIEITLTIAVSYFAYYTAQE----WAGASGVLTVMTLG
MFYAAFARTAFKGDSQ-KSLHHFWEMVAYIANTLIFILSGVVIAEGILDSD-KIA-----
------YQGNSWRFLFLLYVYIQLSRVVVVGVLYPLLCRF--G-YGLDWKESIILVWSGL
RGAVALALSLSVKQSSG--N---SHISKETGTLF-LFFTGGIVFLTLIVNGSTTQFVLRL
LRMDILPAPKKRI-LEYTKYEMLNKALRAFQDLGDD---EELG-PADWPT-VES------
--YISSLKGS----EGE----------LVH----------HPHN---GS---KIG-----
---------------------------------------------SLDPKS-LKDIRM-R
FLNGVQATYWEMLDEGRISEVTANILMQSVDEALDQVS--T-------------------
---------TLCDW-RGLKPHVN--FPNYYNFL---------------------------
---------------------------------------------HSKV-VPRKL-----
------------------------------------------------------------
-------------------------------VTYF-------------AVERLESACYI-
-------SAAFLRAHTIA---RQQL-YDFLGESNIG------------------------
----------------SIVINES---EKEGEEAKKFLEK-VRSSFPQVLRVVKTKQVTYS
VLN---HLLGYIENLEKVGLLEEKE-----------------IAHLHDAVQTGLKKLLRN
--PPI-------------------------------------------------------
------------------------------------------------------VKLPKL
SDMITSHP---------------------------LS------VALPPAFCE-----PLK
HSKKEPMKLRGVTLYKEGSK-PTGVWLIFDGIVKWKSK--------------I-LSNNHS
LHPT----------------------------FSHGSTLGLYEVL-TG-----KPYLCDL
--ITDSMVL-CFFIDSEKILSL-QS----DST--IDDFLWQESALVLL-KLLRPQIFESV
AMQELR---ALVST-ESSKLTTYVTGESIEIDCNSIGLL---------------------
--LEGFVKPVGIKEE-LISSP-AAL--SPSNGNQ-SFHNSSE--ASGI--MRVSFSQQAT
QY-IVETRARAIIFNIGAF-GADRTLHRRPSSLTPPRSSS-SD-QLQRS--------FRK
EHRGLMSWPENIYAK-QQ-------------QEINK-TTLSLSERAMQLSIFGSMVNVY-
------RRSVSF--------GGIYNNKLQDNLL----------------YKKLPLNP---
--------AQGLVSAKSESSIVTKKQLETRKHACQL-------------------PLKGE
S-----STRQNTM-VESSDEEDEDEGIVVR-IDSPSKIVFRN---------------D--
----L
>gi|106364303|dbj|BAE95196.1|	   1169 residues, 50 /line  putative Na+/H+ antiporter [Suaeda japonica]
--------------------------MAASRI---EVPFPFM-------LAEDVTSPSSS
------------------------------------------------------------
------------------------------------------------------------
-NSTVSAV-LEEESNPTDAVIFFGASLI-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIACRH
F--LRGTRVPYTVALLVIGIGLGSL-EYGTKHG--VGRFGDGIRIWENIDPEL-------
--------------LLAVFLPALLFESSFSMEIHQIKRCIAQMVLLAGPGVLLSTCILGA
ALKL-------TFPYG---WNWKTSLLLGGLLSAT--DPVAVVALLKE-LGA-SKKLSTI
IEGESLMNDGTAIVVYQLFYQM--VL-----GR-SF-----TWVAIVKFLLQ---VALGA
VGMGIVFGAASVLWLGFIFNDTVIEISLTLAVSYVAYFTAQE----GADVSGVLTVMTLG
MFYAAAARTAFKGESQ-QSLHHFWEMVAYIANTLIFILSGAVIAQGVLSSDNIFE-----
------NHGIAWGYLFLLYAYVLVGRAIVVGVLFPFLRYF--G-YGLEWREALILIWAGL
RGAVALSLSLSVKRSSG--D--PALLSTQTGTLF-VFFTGGIVFLTLIVNGSTTQFLLSS
LGMNKLSKAKRRI-LDFTKYEMEKKALDAFGDLGED---EELG-PADWAT-VKR------
--YIKSLNTL----DEE----------RIH-----------PHE---ASGTENDG-----
---------------------------------------------YLDPMN-LKDMRV-R
LLNGVQAAYWAMLDEGRITQNTANVLMQSVDEALDKVDY-E-------------------
---------PLCDW-KGLKSSVQ--FPNYYRFL---------------------------
---------------------------------------------QGSI-YPKKL-----
------------------------------------------------------------
-------------------------------VTFF-------------TVERLESACSI-
-------CAAFLRAHRIV---RGQL-HDFIGDSEVS------------------------
----------------FAIINES---EAEGEEARKFLED-VRITFPQVLRVVKTRQATFA
VLQ---HLIHYIESLEKAGILEEKE-----------------MVHLHDAVQTDLKRLLRN
--PPT-------------------------------------------------------
------------------------------------------------------VKLPKV
GDLICTHP---------------------------FL------GALPEGLRN-----RLV
GSTKEEVKVRGMTLYKEGGK-PNGIWLISNGVVKWASK--------------S-SKNKHV
LHPT----------------------------FTHGSTLGLYEVL-IG-----KPYFCDM
--ITDSVAV-CFFIEAEKIQAVLGS----DPA--VEHFFWKESVIVLA-KVLLPRFFENK
SMQDMR---MLT-A-ERSTLNTYLRGETIEVPPHSIGFL---------------------
--LEGFIKSHSLVEE-LITSP-APL--FPAQGNS-SFLN-QNHNGSGYN-KSTSFSHQGA
SY-YVETRARVLLIDMSQS-QPESTLQRRKSSFLL-----PEQ-SARNL--------TNR
EHSGLLSWPENQYRS-HQQL--PTG------QEI-E-ESENLSAKAMQLSIYGSMVPSR-
------GESFKEAPMRGQSFKGDNLGNPSHVRS----------------YPQVPFSDQ--
-------EQRSLTSVKSEGSTAVRKRLAEEGIKQEL------------------LPPAHS
S-----RHPSHAR-DDSSSESGGDEDVIVR-IDSPSKLSFRQ---------------A--
----P
>gi|116077879|emb|CAL44986.1|	   1050 residues, 50 /line  putative Na/H antiporter [Cymodocea nodosa]
--------------------------MAAVED---GALPYRK-------LLEEV------
------------------------------------------------------------
------------------------------------------------------------
-NGTVTGE-GRSESTPQDGIIFVGVSLV-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIASRH
M--LRGTRVPYTVALLLLGIGLGAL-EFQTSNG--LGKLGSGIRLWSHINPEL-------
--------------LLGVFLPALLFESSFGMEVHQIKKCLAQMILLAGPGVIASTFCLGS
LLKL-------TFPYN---WDWKTSLLLGGLLSAT--DPVAVVALLKD-LGA-SKKLNTI
IEGESLMNDGTAIVVYQLFYDM--VL-----GQ-EF-----SAGSIIKFLCE---VSLGA
VAVGLAFGIVSVLWLHYIFNDTVIEVTLTLAVSYIAFYTSQD----AIKVSGVLSVMTLG
MFYAVAARTAFKGETH-ESLHHFWELVSYIANTLIFILSGVVIGENVMSDKSSFE-----
------SDGAKWGYLILLYVYVQLSRATVVGILFPFLRYF--G-YGLGLKEAAILIWSGL
RGAVALALSLSVKRAGD--SLESPSLKQDVGTSF-VFFTGGIVLLTLIINGSTTQFLLHF
FAMDKLPDAKIRI-LNYTKYEMLNKAMETFDDLGDD---EDLG-PVDWPT-VKK------
--YITCLNDL----EGV----------QEN-----------PHT---IS--ESEN-----
---------------------------------------------QLHDMN-LSDTRV-R
LLNGVQAAYWEMLEEGRITQTTGILLMQSVDEAMDTVSH-E-------------------
---------TLCDW-KALKAHVH--FPKYYKFL---------------------------
---------------------------------------------QMSR-IPQGL-----
------------------------------------------------------------
-------------------------------VTYF-------------TVERLESACYI-
-------SAAFLRAHRIA---RRQL-REFIGESEIA------------------------
----------------TAVINES---EEEGQEARNFLED-VRISFPQVLCAVKAKQVTYS
VLK---NLSEYVQTLEKIGLLEEKE-----------------MLQLDDAVQTDLKKLLRK
--PPS-------------------------------------------------------
------------------------------------------------------VVMPKL
KDLLDRHP---------------------------LL------GVLYKQVQV-----PFE
KSTKEIMKTEGRTLYREGSK-PKGIWLISSGVFKWAST--------------T-LSSRQS
LHPD----------------------------FLHGSPLGLYEVL-AG-----KRFICDM
--VTDSLVH-CFFIKAEKILPLLRS----DPE--VEELLWRESSIVIA-KLLLPLVFENL
PLQEVQ---GLL-N-ERSRMDTYVSGESIEIPHNSVCIL---------------------
--LEGSLESQDAHRS-LIASP-AVL--LPSNVAP-SFLN-LE--SSGT--VPASCCHRGN
SY-MVEAIARVVRFEIGAN-ERRSPPQWRQSLCMP-----QSV-GPQRL--------PVR
EQCGLLSWPENLQRA-RSHP--QVL------NAYGH-QANNMSARGTGLHNFRSMV----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----
>gi|119359748|dbj|BAF41924.1|	   1129 residues, 50 /line  Na+/H+ antiporter [Phragmites australis]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------MGDPDDAVLFVGVSLV-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIASRH
L--LRGTRVPYTVALLVLGVALGSL-EYGTQHG--LGKLGSGIRIWANINPDL-------
--------------LLAVFLPALLFESSFSMEIHQIKRCMAQMVLLAGPGVIISTFLLGT
AVKL-------TFPYN---WSWKTSLLLGGLLSAT--DPVAVVALLKE-LGA-SNKLSTI
IEGESLMNDGTAIVVYQLFYRM--VL-----GR-TF-----DAGSIIKFLSQ---VSLGA
VALGLAFGIVSVLWLGFIFNDTIIEIALTLAVSYIAFFTAQD----SLEVSGVLTVMTLG
MFYAAFAKTAFKGDSQ-QSLHHFWEMVAYIANTLIFILSGVVIADGVLQNNVHFE-----
------RHGTSWGFLVLLYVFVQISRVVVVGVLYPLLRHF--G-YGLDLKEAAILVWSGL
RGAVALSLALSVKRTSD--AVQ-PYLKPEVGTMF-VFFTGGIVFLTLILNGSTTQFLLHI
LGLDKLSATKLRI-LKYTRYEMLNKALEAFGELRDD---EELG-PADWVT-VKK------
--YITCLHDL----GDE----------PEH-----------PHD---VS--DKDD-----
---------------------------------------------RMHTMN-LRDIRV-R
LLNGVQAAYWGMLEEGRINQATANILMRSVDEAMDLVSR-Q-------------------
---------PLCDW-KGLQSSVQ--FPNYYRFL---------------------------
---------------------------------------------QMSK-LPRKL-----
------------------------------------------------------------
-------------------------------ITYF-------------TVERLESGCYM-
-------CAAFLRAHRIA---RRQL-HDFLGDSEVA------------------------
----------------RIVIDES---NAEGEEARKFLED-VRITFPQVLRVLKTRQVTYS
VLT---HLSGYIQNLQKTGLLEEKE-----------------MVHLDDALQTDLKKLKRN
--PPL-------------------------------------------------------
------------------------------------------------------VKMPRV
SELLNNHP---------------------------LV------GALPAVSRD-----LLL
SNTKETVRGHGTNLYREGSR-PTGIWLVSIGVVKWTSQ--------------R-LSSRHS
LDPI----------------------------LSHGNTLGLYEVL-IG-----KPYICDM
--ITDSVVH-CFFIEAEKIEQLRQS----DPS--IEVFLWQESALVIA-RLLLPQIFEKM
AMHEIR---VLI-A-ERSTMNIYIKGEDIELEQNYIGIL---------------------
--LEGFLKTKN--QN-LITPP-GVL--LPSNTDL-NLFG-LE--SSAM--NHIDYCYTAP
SY-QVEARARIIFFEIGRVWETQPDLQ-RTVSLLA-----QTH-EPPRT--------LSK
EHSGLLSWPESFRKS-RGPHN-VSF------AEMRN-QPGSLSARALQLSMYGSMINDM-
------HSG----QGQRRQRHRMQATNQKHSSS----------------YPRVPSRPS--
-------NARPLLSVQSEGSNMKRMAAPKEAGE--A------------------PAPATS
AG--QRRRKAMEA-NNSSDDESAGEEVIVR-VDSPSMLSFRQ---------------PS-
----K
>gi|57117296|gb|AAW33875.1|	   1148 residues, 50 /line  Na+/H+ antiporter [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------M-DNPEAEPDDAVLFVGVSLV-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIASRH
L--LRGTRVPYTVALLVLGVALGSL-EFGTKHG--MGKLGAGIRIWANINPDL-------
--------------LLAVFLPALLFESSFSMEIHQIKKCMAQMVLLAGPGVLISTFFLGS
ALKL-------TFPYN---WNWKTSLLLGGLLSAT--DPVAVVALLKE-LGA-SKKLSTI
IEGESLMNDGTAIVVYQLFYRM--VL-----GR-TF-----DAGSIIKFLSE---VSLGA
VALGLAFGIASVLWLGFIFNDTIIEIALTLAVSYIAFFTAQD----ALEVSGVLTVMTLG
MFYAAFAKTAFKGDSQ-QSLHHFWEMVAYIANTLIFILSGVVIADGVLENNVHFE-----
------RHGASWGFLLLLYVFVQISRILVVVILYPLLRHF--G-YGLDLKEATILVWAGL
RGAVALSLSLSVKRASD--AVQ-THLKPVDGTMF-VFFTGGIVFLTLIFNGSTTQFLLHL
LGMDRLAATKLRI-LNYTKYEMLNKALEAFGDLRDD---EELGPPADWVT-VKK------
--YITCLNDL----DDE----------PVH-----------PHA---VS--DRND-----
---------------------------------------------RMHTMN-LRDIRV-R
LLNGVQAAYWGMLEEGRITQTTANILMRSVDEAMDLVPT-Q-------------------
---------ELCDW-KGLRSNVH--FPNYYRFL---------------------------
---------------------------------------------QMSR-LPRRL-----
------------------------------------------------------------
-------------------------------ITYF-------------TVERLESGCYI-
-------CAAFLRAHRIA---RRQL-HDFLGDSEVA------------------------
----------------RIVIDES---NAEGEEARKFLED-VRVTFPQVLRVLKTRQVTYS
VLT---HLSEYIQNLQKTGLLEEKE-----------------MAHLDDALQTDLKKFKRN
--PPL-------------------------------------------------------
------------------------------------------------------VKMPRV
SDLLNTHP---------------------------LV------GALPAAMRD-----PLL
SSTKETVKGHGTILYREGSR-PTGIWLVSIGVVKWTSQ--------------R-LSSRHS
LDPI----------------------------LSHGSTLGLYEVL-IG-----KPYICDM
--ITDSVVH-CFFIEAEKIEQLRQS----DPS--IEIFLWQESALVVA-RLLLPMMFEKM
ATHELR---VLI-T-ERSTMNIYIKGEEIELEQNFIGIL---------------------
--LEGFLKTKN--QT-LITPP-GLL--LPPNADL-NLFG-LE--SSAI--NRIDYCYTAP
SY-QVEARARILFVEIGRP-EIEADLQ-RSASLIS-----QTL-ELPRT--------QSK
EHSGLLSWPESFRKS-RGAQNGASL------TEIRD-HPASFSARALQLSMYGSMINDM-
------KSGQGQGQRRQRHRHTKASSNKAHSSS----------------YPRVPSRSSN-
-------TQRPLLSVQSEGANMTTARQAAAAGASLP------------------PEPEEA
GRRRRRQRKAIEEDEDNSSDESAGEEVIVR-VDSPSMLTFRQ---------------PSS
AAD-R
>gi|124301345|gb|ABN04857.1|	   1146 residues, 50 /line  salt-overly-sensitive 1 [Thellungiella halophila]
--------------------------MATVIE---AVMPYR--------LLEDETG----
------------------------------------------------------------
------------------------------------------------------------
-------S-PEGESSPVDAVLFVGMSLV-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIASGH
L--LRGTRVPYTVALLVIGIALGSL-EYGTHHN--LGKLGHGIRIWNEINPEL-------
--------------LLAVFLPALLFESAFSMEVHQIKRCLGQMVLLAGPGVLISTFCLAS
LVKL-------TFPYD---WDWKTSLLLGGLLSAT--DPVAVVALLKE-LGA-SKKLSTV
IEGESLMNDGTAIVVFQLFLKM--VM-----GH-SS-----GWSSIITFLIR---VALGA
VGIGIAFGIASVLWLKFIFNDTVIEITLTIAVSYFAYYTAQE----WAGASGVLTVMTLG
MFYAAFARTAFKGDSQ-RSLHHFWEMVAYIANTLIFILSGVVIAEGILDSD-KIA-----
------YQGSSWGYLFLLYLYIQLSRCVVVGVLYSFLCRV--G-YGLDWKEAIILVWSGL
RGAVALSLSLSVKQSSG--N---SFLSTETGTMF-IFFTGGIVFLTLIVNGSTTQFALRL
LRMDGLPASKIRI-LDYTKYEMLNKALQAFEDLGDD---EELG-PADWPT-VES------
--YISSLKDS----EGE----------QVH-----------PHS---GS--KPG------
---------------------------------------------NLDHTS-LKDIRI-R
FLNGVQAAYWEMLDEGRISESTANILMRSVDEALDHIST-E-------------------
---------PLCDW-RGLKSHVK--FPGYYNFL---------------------------
---------------------------------------------HSKI-IPGKL-----
------------------------------------------------------------
-------------------------------VIYF-------------AVDRLESACYI-
-------SAAFLRAHTIA---RQQL-YDFLGESNIG------------------------
----------------STVIKES---ETEGEEAKEFLEK-VRSSLPQVLRVVKTKQVTYS
VLS---HLLDYIQNLEKIGLLEEKE-----------------IAHLHDAVQTGLKKLLRN
--PPI-------------------------------------------------------
------------------------------------------------------VKLPKL
SDLITSHP---------------------------LS------GALPSAICE-----PLK
HSKKETMKLRGVTLYKEGSK-PTGVWLIFDGIVKWKSK--------------G-LSNNHS
LHPT----------------------------FSHGSTLGLYEVL-TG-----KPYMCDV
--ITDSVVL-CFFINSERILSYVQS----DST--IEDFLWKESALVLL-KLLRPQTFEKV
PMHELR---ALVSA-ESSKQTTYVSGESIEIDHNSVGLL---------------------
--LEGFIKAVGIQEELLIASP-AAL--LHSNENQ-SFRNSSE--ASGI--LRVSFSRQAA
RY-SVETRARVIIFNHGAF-GAHRTLQRKPSTLASPRATSSDH-QLKRS--------ASK
EHRGLMRWPENIYKA-GQE------------EEMNG-KTLNLSERAMQLSIFGSTENLY-
------KRSVSF--------GGLNNNKAQDNLS----------------YKKLPSTS---
--------AQGLFSAKSEGSMATTKQVESRKFVSQL-----------------PPLAASA
EGSS---RRETMA-EESSDDE--GEGIIVR-IDSPSTIVFRN---------------D--
----L
>gi|124301347|gb|ABN04858.1|	   1151 residues, 50 /line  salt-overly-sensitive 1 [Mesembryanthemum crystallinum]
--------------------------MAALTD---FQLPLR--------LAEEVAANATS
------------------------------------------------------------
------------------------------------------------------------
--AAAAVA-AESETNPTDAVIFVGVSLV-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIACRH
F--LRGTKVPYTVALLIIGIGLGSL-EYGTKHG--LGRFGDGIRLWEHIDPEL-------
--------------LLAVFLPALLFESSFSMEVHQIKRCIIQMLILAGPGVLISTFCLGS
ALKL-------SFPYD---WNWKTSLLLGGLLSAT--DPVAVVALLKE-LGA-SKKLSTI
IEGESLMNDGTAIVVYQLFFQM--VL-----GR-SF-----NVAQIIKFLVQ---VSLGA
VGIGLAFGVVSVLWLGFIFNDTIIEISLTLAVSYVAYFAAQE----AADVSGVLTVMTLG
MFYAAAARTAFKGESQ-ESLHHFWEMVAYIANTLIFILSGAVIAEGVLNSGHIFE-----
------NNGISWGYLVLLYVYVLASRAVVVTVLFPFLRYF--G-YGLEWKEAVILTWSGL
RGAVALSLSLSVKRSSG--D--ASLLSAQTGTLF-VFFTGGIVFLTLIVNGSTTQFVLHF
LGMDRLSAAKRRI-LEFTKFEMEKRALEAFGDLGED---EELG-PADWPT-VKR------
--YIKSLNS-----GGE----------QIH-----------PHD---NS--TSGG-----
---------------------------------------------DLDPMS-LTDIRV-R
LLNGVQAAYWVMLDEGRISQSTANILMQSVDEALDSVTH-E-------------------
---------PLNDW-NGLKRNVH--FPNYYRFL---------------------------
---------------------------------------------QGSSMWPRKL-----
------------------------------------------------------------
-------------------------------VTFF-------------TVERLESGCYI-
-------CAAFLRAHRIA---RRQL-YDFIGESEIA------------------------
----------------TAVINES---ETEGEEARKFLED-VRITFPEVLRVVKTRQVTHS
VLK---HLIDYIHSLEKAGLLEEKE-----------------IHHLHDAVQTDLKRVLRN
--PPL-------------------------------------------------------
------------------------------------------------------VKLPKA
KDLVSTHP---------------------------LL------GALPATARD-----VLV
NSTKEVVKVRGLTLYKEGSR-PNGIWLISNGVVKWGSK--------------S-RVIKHA
FHPT----------------------------FTHGSTLGLYEVL-IG-----KPYLCDM
--ITDSVVV-CFFVEAEKILSVLGS----DFE--MENFLWKESVIGLA-KILLPQIFEKM
SMHDLR---LLI---ERSTMNTYLSGENVEVPPHAIGFL---------------------
--LEGFIKCHSLHEE-LITSP-AAL--WPAQGNS-SFLS-QD--GTGY--KSTSFYSQGC
SY-YVETRARVIVFDINSF-QHDKTLMRRKSSLLL-----HDQ-STISL--------TSR
DHGGLVSWPENARPE-REGED---E------EEIDE-HEQNMSARARQLSIYGSMLKEK-
------DPLLK----TVSFHESVLNKPSSHSLS----------------YPTVPD--A--
-------QGRSLTTVKSEGSHTIRKRLEG-----DL-----------------PDIPSVP
H---SRRPSQL---PESSDESGGEEDVIVR-IDSPSRLSFRH---------------A--
----P
>gi|130917793|gb|ABO32636.1|	   1137 residues, 50 /line  plasma membrane Na+/H+ antiporter [Puccinellia tenuiflora]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------M-EEAGSSPDDAVLLFGVSLV-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIGSRH
L--LRGTRVPYTVALLVLGVALGSL-EYGTKHG--LGKLGAGIRIWAAINPDL-------
--------------LLAVFLPALLFESSFSMEVHQIKKCMAQMVLLAIPGVVLSTVLLGS
AVKL-------TFPYN---WSWKTSFLFGGLLSAT--DPVAVVALLKD-LGA-SKKLSTI
IEGESLMNDGTAIVVCQLFYRM--VL-----GT-TF-----DAGSIIKFLTQ---VSLGA
VALGLAFGIASVLWLGFIFNDTIIEISLTLAVSYIAFFTAQD----AFEASGVLAVMTLG
MFYAAFAKTAFKGDSQ-ESLHHFWEMVAYIANTLIFILSGVVIADGVLQDNIHFE-----
------RHGASWGFPLLLYVFVLTGRAVVVTVLYPLLRHF--G-YGMDVKEATVLVWSGL
RGAVALSLSLSVKRASD--ADQ-PNLKSEVGTMF-VFFTGGIVFLTLIVNGSTTQFLLHL
LGLGKLSATKLRV-LKYTRYEMLNKAKEAFGDLRDD---EELG-PADWIT-VKK------
--YITCLNNL----EDE----------QAH-----------PHD---AP--DKDE-----
---------------------------------------------SVHTMN-LRDTRV-R
LLNGVQAAYWGMLEEGRITQATANILMRSVDEAMDLVST-Q-------------------
---------SLCDW-KGLRSNVH--LPKYYRFL---------------------------
---------------------------------------------QMSR-LPRRV-----
------------------------------------------------------------
-------------------------------VTYF-------------TVERLELGCYI-
-------CAAFLRAHRIA---RRQL-HDFLGDSEIA------------------------
----------------RIVIDES---TAAGEEAKKFLED-VRLTFPQVLLALKTRQVTYA
VLT---HLSEYIQDLGKTGLLEEKE-----------------MVHLDDALQTDLRKLKRN
--PPL-------------------------------------------------------
------------------------------------------------------VKMPRA
SEILNTHP---------------------------LV------GALPAAVRD-----PLL
SNTEETIKVHGTILYSEGSR-PTGIWLVSTGIVKWTSQ--------------R-LSTRHS
LDPI----------------------------LSHGSTLGLYEAL-VG-----KPYICDI
--ITESVVH-CFFIEAETIEQLRQS----DPS--IEDFLWQESALVIA-RIFLPQIFEKM
AMREMR---VLI-S-ERSTMNIYIKGEDIELGPNYVCIL---------------------
--LEGFLQM-N--QT-LITPP-AVL--LPSNTDL-NVFG-LQ--SSAM--NHIDYCYTAP
SY-QVTARARAILFDIRRP-EAESDLQ-RSASLLS-----PNL-GPPRT--------QSK
EHIGLLRWPQSFHHRSRGPGN-PSL------AEIGK-QPGSFSASALQVSMYGTMMDDE-
-----MHTA------QPRPRPDRVEANQKHSAS----------------YPKVPSRSLS-
-------NTRPLLSVRSEGSNMMKRKSAPAPAHAPALD---------------PFPP-LA
GGR---HHRAITE-GDLSSDESAGEEVIVR-VDSPSMLAFQP---------------RP-
--QGN
>gi|37499122|gb|AAQ91618.1|	   1142 residues, 50 /line  putative plasma membrane Na+/H+ antiporter [Triticum aestivum]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MET-G-EAGSPSPDDAVLFFGVALV-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIASRH
L--LRGTRVPYTVALLVLGVALGGL-EYGTKHG--LGKLGAGIRIWSAINPDL-------
--------------LLAVFLPALLFESSFSMEVHQIKKCMAQMVLLAVPGVVISTVLLGA
AVKL-------TFPYD---WNWKTSFLFSGLLSAT--DPVAVVALLKD-LGA-SKKLSTI
IEGESLMNDGTAIVVYQLFYRM--VL-----GK-TF-----DAGSIIKFLSQ---VSLGA
VALGLAFGIASVLWLGFIFNDTIIEISLTLAVSYIAFFTAQD----ALEVSGVLAVMTLG
MFYAAFAKTAFKGDSQ-QSLHHFWEMVAYIANTLIFILSGVVIADGVLQDNIHFE-----
------RHGTSWGFLVLLYVFVQISRAVVVGVLYPLLRHF--G-YGMDIKEATVLVWSGL
RGAVALSLSLSVKRASD--SVQ-TYLKPEVGTMF-VFFTGGIVFLTLILNGSTTQFLLHL
LGLGKLSATKLRV-LKYTQYEMLNKALEAFGDLRDD---EELG-PVDWVN-VKK------
--YITCLNNL----EDE----------QAH-----------PHD---VP--DKDD-----
---------------------------------------------HIHTMN-LKDTRV-R
LLNGVQAAYWGMLEEGRITQSTANILMRSVDEAMDLVSS-Q-------------------
---------SLCDW-KGLRSNVH--FPNYYRFL---------------------------
---------------------------------------------QMSR-LPRRL-----
------------------------------------------------------------
-------------------------------VTYF-------------TVERLELGCYI-
-------CAAFLRAHRIA---RRQL-HDFLGDSEIA------------------------
----------------RIVIDES---TAVGEGAKKFLED-VRVTFPQVLRALKTRQVTYA
VLT---HLSEYIQDLGKTGLLEEKE-----------------IVHLDDALQTDLKKLKRN
--PPL-------------------------------------------------------
------------------------------------------------------VKMPRV
RELLNTHP---------------------------LV------GALSADVRD-----PLL
SNTKETIKVHGTILYREGSR-RTGIWLVSTGIVKWTSR--------------R-LCTRHS
LDPI----------------------------LSHGSTLGLYEAL-TG-----KPYICDI
--ITESVVH-CFFIEAEKIEQLRQS----DPS--IEDFMWQESALVIA-RILLPQIFEKM
AMREMR---VLI-S-ERSSMNVYIKGEAIELGHNNVGIL---------------------
--LEGFLKTEN--RT-LITAP-AVL--LPSNTDL-NLFG-LQ--SSAM--NQIDYCYTAP
SY-QVEARARAIIFEIGRL-DIEADLQ-RSASLLS-----STL-GPSRT--------QSK
EHVGLLRWPESFRRS-SGPGN-ASL------AEIRG-QPGSFSARALQVSMYGSMTDG--
-----MHRA------RRQPRLAHVEGNQKHSVS----------------YPKVPSRA-A-
-------DTRPLLSVRSEGSNAMKRKSAPAPAIAPALA---------------PFPPPLA
EGQ---QRRAVGE-DDDSSDESVGEEVIVR-VDSPSMLSFNP---------------PSG
PPRGS
>gi|65432047|gb|AAY42598.1|	   1110 residues, 50 /line  SOS1 [Lolium perenne]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------GSTSPRASPQS--------------------------------------
------------------------------------------------------------
--------------------------------------------------------IHRS
F--LRSKFVIFFCFL----SSPRRS-EYGTKHG--LGKLGAGIRIWAGINPDL-------
--------------LLAVFLPALLFESSFSMEVHQIKKCMAQMVLLAVPGVVISTVLLGT
AVKL-------TFPYD---WNWKTSFLFSGLLSAT--DPVAVVALLKD-LGA-SKKLSTI
IEGESLMNDGTAIVVYQLFYRM--VL-----GT-TF-----DAGSIIKFLSE---VSLGA
VALGLAFGIASVLWLGFIFNDTIIEISLTLAVSYIAFFTAQD----ALEVSGVLAVMTLG
MFYAAFAKTAFKGDSQ-ESLHHFWEMIAYIANTLIFILSGVVIADGVLQDNIHFE-----
------RHGASWGFLLLLYVFVQLSRAVVVIVLYPLLRHF--G-YGMDVKKATVLVWSGL
RGAVALSLSLSVKRASD--AVQ-LYLKPEVGTMF-VFFTGGIVFLTLIVNGSTTQFLLHL
LGLGKLSATKLRV-LKYTRYEMLNKALEAFGDLRDD---EELG-PADWIT-VKK------
--YITCLNNL----EDE----------QAH-----------PHD---VP--DKDE-----
---------------------------------------------SVHTMN-LKDTRV-R
LLNGVQAAYWGMLEEGRITQSTANILMRSVDEAMDLVSG-Q-------------------
---------SLCDW-KGLRSNVH--FPNYYRFL---------------------------
---------------------------------------------QMSR-LPRRL-----
------------------------------------------------------------
-------------------------------VTYF-------------TVERLQLGCYI-
-------CAAFLRAHRIA---RRQL-HDFLGDSEVA------------------------
----------------RIVVDES---TAAGEEAKKFLED-VRVTLPQVLRALKTRQVTYA
VLT---HLSEYIQDLGKTGLLEEKE-----------------MAHLDDALQTDLKKLKRN
--PPL-------------------------------------------------------
------------------------------------------------------VKMPRV
SELLNTHP---------------------------LV------GALPAAVRD-----PLS
SNTKETIKVHGTVLYTEGSR-PTGIWLVSTGIVKWTSQ--------------R-LSTRHS
LDPI----------------------------FSHGSTLGLYEAL-VG-----KPYICDI
--ITESVVH-CFFIEAEKIEQLRQS----DPS--IEDFMWQESALVIA-RIFSPSDIEKM
AMHEMR---VLI-S-ERSMLNIYIKGEDIEPGHNYVGIL---------------------
--LEGFLKM-N--NH-LITPP-AVL--LPSNTDL-NVFG-LQ--SSVM--NHIDYCYTAT
SY-QVEARARAILFEIRRP-EAESDLQ-RSASLLS-----PTL-GPSRT--------QSK
EHVGLVRWPESFRRS-RGPGN-PSL------VD--I-GSQSFSARALQVSMYGSMMDDM-
------HPA------QRRQRPHPVKANQEHSAS----------------YPKVPSRVMS-
-------NSRPLLSVQSEGSNLMNRKSAPAPAIA-------------------PFPP---
-RR---QRRAIAE-EDNSSDESVEEEIIVR-VDSPSMFTFHP---------------PS-
--QGS
>gi|66765937|emb|CAG30524.1|	   1151 residues, 50 /line  putative plasmalemma Na+/H+ antiporter [Solanum lycopersicum]
--------------------------MELLVE----TRPFR--------IVEESIS----
------------------------------------------------------------
------------------------------------------------------------
-----A-----ESSDPTNAVIFVGISLL-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIGCRH
L--LRGTRVPYSVALLVLGIGLGAL-EYGTHHG--LGRIGDGIRIWANIDPDL-------
--------------LLAVSFPALLFESAFSMEIHQIKRCAVQMLLLAGPGVLISTFFLGA
ALKI-------AFPYN---WSWSTSLLLGGLLSAT--DPVAVVALLKE-LGA-SKKLGTI
IEGESLMNDGTAIVVYQLLLRM--VT-----GW-TF-----NWGAVIKFLVQ---VSLGA
VGFGIAFGIASVLWLGFIFNDTVIEISLTLAVSYVAYFTAQQ----GADVSGVLTVMTLG
MFYSAVAKTAFKGESH-QSLHHFWEMVSYIANTLIFILSGVVIAEGILAGDNIFK-----
------IYDNSWGYLILLYVLILVSRAVVVGVLYPFLRYF--G-YGLDLKEAFILVWGGL
RGAVALSLSLSVKRSSD--G--SQYISSDTGTLF-VFLTGGVVFLTLIINGSTTQFALHY
LGMDKLSAAKKRI-LNYTKYEMLNKALEAFGDLGDD---EELG-PADWPT-VKR------
--YITSLNDV----EGE----------PVH-----------PHT---SS--GNDD-----
---------------------------------------------NVDHMH-LEDIRI-R
LLNGVQAAYWEMLNEGRIPQTIANLLMQSVEEANDVVSH-E-------------------
---------PLCDW-KGLKSYVN--IPNYYKFL---------------------------
---------------------------------------------QTSF-VHRKL-----
------------------------------------------------------------
-------------------------------VTYF-------------TVERLESACYI-
-------CAGFLRAHRTA---RQQL-NEFIGESEIA------------------------
----------------SLVIKES---EEEGEDARKFLEE-VRVSFPQVLRVVKTRQVTYA
VLN---HLIDYVHNLEKIGILEEKE-----------------MAHLHDAVQTDLKRLVRN
--PPL-------------------------------------------------------
------------------------------------------------------VKFPKI
RDLISVNP---------------------------LL------GALPPTVRE-----TLI
GSTKEIMKLRGATLYEEGSK-ATRVWLISNGVVKWSSK--------------S-TSNIHL
LHPT----------------------------FSHGSTLGLYEVL-VG-----KPYICDI
--ITDSVAL-CFSVDNERILTALRS----DPA--VEDFFWQESALVLA-KVLLPQMFETT
KMQDMR---TLV-A-ERSTMSIYIRGESFELPHHSIGFL---------------------
--LEGFVKSHGSHEG-LLSAP-APL--LPLALEQQSFHN-TE--ASGV--HAASFSHQPS
QY-QVETRARVIMFDIAGF-LSGRGLQRRSSSLLS-----HSIDHPSRS--------FSR
ELGGLMSWPENTYKA-MQH--RQDV------ERTGQ-QETNMSTRAMQLNIFGSMISDT-
-----RSRSRSF--------PGISAAKTSHSQS----------------YPEVRS---D-
-------GVQTLVSVRSEGSTTLRKKAQVQGENKDMS-----------------IQLPSA
PI---EESDTR---EYSSDDSGGEDEHLIR-IDSGRPSFPQW---------------IAE
EDKTS
>gi|99029169|gb|ABF60872.1|	   1145 residues, 50 /line  Na+/H+ antiporter [Populus euphratica]
--------------------------MGSAIEKG-VGLPYR--------ILESSSS----
------------------------------------------------------------
------------------------------------------------------------
-----SSA-ASDEWNPTDTVLFFGFSLL-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIACRH
L--LRGTRVPYTVALLVVGIALGSL-EYGTSHK--LGRIGDGIRLWAHIDPDL-------
--------------LLAVFLPALLFESSFSMEVHQIKRCMGQMLLLAVPGVLISTCCLGC
ALKL-------IFPYN---WSWTTSLLLGGLLSAT--DPVAVVALLKE-LGA-SKKLSTI
IEGESLMNDGTAIVVYQLFYRM--VL-----GE-SF-----NSGAIIKFLTQ---VSLGA
VGIGIAFGIASFLWLGFIFNDTVIEIALTLAVSYVTYFTAQE----GAAVSGVLAVMTLG
MFYAAVARTAFKGDGQ-QSLHHFWEMVAYIANTLIFILSGVVIAEGVLSSGNTFH-----
------RHAHTWGYLFLLYAFVLLSRFIVVGVLYPILRYF--G-YGLEWKEAIIVIWSGL
RGAVALSLSLSVKRTSD--S--SVYLSSDTGTLF-VFFTGGIVFLTLIVNGSTTQFILHL
LDMDKLSATKKRL-LNFTKYEMLNKALEAFGDLGED---EELG-PVDWPT-VKR------
--YIPSLNSL----EGS----------CEH-----------PHG---AS--EADN-----
---------------------------------------------NLDPTN-LKDIRI-R
LLNGVQAAYWGMLDEGRITQTTANILMQSVDEAIDLASH-E-------------------
---------PLCDW-KGLQSNVH--FPNYYKFL---------------------------
---------------------------------------------QASI-FPQKM-----
------------------------------------------------------------
-------------------------------VTYF-------------TVERLESACYI-
-------CAAFLRAHRIA---RRQL-HDFIGDSGIA------------------------
----------------SLVINES---NAEGEEARKFLED-VRVTFPQVLRVVKTRQATYS
VLN---HLIDYVQNLEKVGLLEEKE-----------------MLHLHDAVQTDLKRFLRN
--PPL-------------------------------------------------------
------------------------------------------------------VMLPKI
TDLISVHP---------------------------LL------EALPSIVRE-----PLE
RSSKEIMKPRGVPLYKEGSK-PNGVWLISSGVVKWTSK--------------S-VRSKHS
LHPT----------------------------FTHGSTLGLYELL-VG-----KRCICDI
--ITDSVVF-CFFIESENMLSLLGS----DPA--IEDFLWQESAIVIA-KLLLPQVFEKM
PMQELR---ALV-A-ERSVMTTYLRGETIEIPHHSIGFL---------------------
--LEGFIKAHGFQDE-LIASP-AVL--LPPQGNQ-SFQK-IG--MSGA--QAASFSHQGS
RY-QVEARARVIIFDIAAF-EADGALRRGSSSLVL-----G--DHPHRY--------FTR
EHGGLMSWPENFYKP-RER--EQNG------VGTSR-SENSLSVRAMQLSIFGSMV-DM-
-----RRHAHSF--------SG-SQVKRSHSLS----------------V--LRN---A-
-------SYQQVRVPSDEATYA-RKSLEVRKLIGKTH-----------------APPPQS
TG--TNETRII---DNYSDESDAEDELVVR-IDSPRTLSFHH---------------A--
----S
>gi|27525521|emb|CAD20320.1|	   1145 residues, 50 /line  putative Na/H antiporter [Cymodocea nodosa]
--------------------------MAAVE-HG--PLSYRM-------FLEEV------
------------------------------------------------------------
------------------------------------------------------------
-NGTVTGE-VKSESSPQDGIIFVGVSLV-L------------------------------
------------------------------------------------------------
------------------------------------------------------GIASRH
V--LRGTRVPYTVALLLLGVGLGAL-EYGTSHG--LGKLGSGIRIWANINPDL-------
--------------LLGVFLPALLFESSFAMEVHQIKRCIVQMILLAGPGVLTSTFCLGS
LLKL-------TFPYN---WDWKTSLLLGGLLSAT--DPVAVVALLKD-LGA-SKKLSTI
IEGESLMNDGTAIVVYQLFYRM--VL-----GE-KF-----GVGSIIKFLSE---VPLGA
VAVGLAFGIVSVLWLGFIFNDTIIEITITLAVSYIAFYTSQE----AIELSGVLTVMTVG
MFYAAAARTAFKGESQ-ESLHHFWEMVAYIANTLIFILSGVVIGESVMRNESNFE-----
------SDGATWGYLILLYAYVQLSRVAVVAILFPLLRYF--G-YGLEFKEALILIWAGL
RGAVALSLSLSVKRASD--SLDSPSLKQEVGTLF-VFFTGGIVFLTLIINGSTTQFLLHF
LAMDKLSAAKIRI-LNYTKYEMLNKAIEAFEDLGED---EELG-PADWPT-VKK------
--YITCLNDL----EGE----------KEH-----------PHT---IT--ESEN-----
---------------------------------------------HLHHIN-LSDTRV-R
LLNGVQAAYWEMLDEGRITQTTGILLMQSVDEAMDTVSH-E-------------------
---------PLCDW-KALKSYVH--FPKYYKFL---------------------------
---------------------------------------------QMSR-IPQRL-----
------------------------------------------------------------
-------------------------------VTYF-------------TVERLESACYI-
-------SAAFLRAHRTA---RRQL-HEFIGESEIA------------------------
----------------AAVINES---NAEGEDARNFLED-VRISFPQVLRAVKTKQVTYS
VLK---HLSEYVQTLEKVGLLEEKE-----------------MLHLDDAVQTDLKKLLRN
--PPL-------------------------------------------------------
------------------------------------------------------VKMPKV
RELLDTHP---------------------------LL------GVLPKQVRV-----PLE
NSTKETMKIKGTTLYKEGSK-PNGIWLISNGVVKWASK--------------T-LSNRQS
LHPT----------------------------FLHGSTLGLYEVL-VG-----KPFICDM
--ITDSLVH-CFFIEAEKIVPLLRS----DPD--IEEFLWQESSIVIA-KLLLPPVFEKL
SLQEVR---GLI-A-ERSRMNIYISGEFIEIPHNSVCIL---------------------
--LEGFLKTQDAHKS-LIASP-AVL--LPSNVEL-SFLS-LE--SSGI--AAASFCHRGN
SY-MAEARARVILFEIGAT-EPPSPLQRRQSSWMS-----HSI-EPQKL----------Q
EHGGLMSWPENLQRA-RSH---QIL------KDSDH-HANNMSTRAMELNIFGSMVEGT-
------H----------KHHAGVPKTSLDFSKS----------------YHRIPSET---
-------SPLPLVSTRSEGESLGKRLGQREKPK---LL---------------PPPPKPV
TGA---SESKPAE-DNSSDESGAEEEIIVR-IDSPSHID---------------------
----I
>gi|33352144|emb|CAD91921.1|	   1153 residues, 50 /line  putative Na/H antiporter [Physcomitrella patens]
----------------------------------------ME-------SMSTV------
------------------------------------------------------------
------------------------------------------------------------
-APAPSTA-ATEEVGPEVAILFVGVALF-L------------------------------
------------------------------------------------------------
------------------------------------------------------GMVSRH
L--FKGSRIPYTVVLLLLGIGIGGL-EYGVKN---LGVLGDSIRMWSNIDPDL-------
--------------ILFLFLPALLFESSFAMDFHQIKRCFFQMLLLAAPGVLISTFLLGV
ATVK-------VFPYN---WNWSTGLLLGGLLSAT--DPVAVVALLKE-LGA-SKKLSTL
IEGESLMNDGTAIVVFRLFLQM--VL-----GK-HF-----SAGDVVSFLSR---VVFGA
VALGLLFGIVSVIWVGRVFNDTVIEITLTLTASYMAFFVAEE----SASVSGVLTVMTVG
IFFTAFARTAFTGESA-QSMHHFWEMISYIANTLVFLLSGVVIAESILRSQDKIQ-----
--------GRDWGYLLLLYLFVQISRAMVVGLLYPGLKYF--G-YGINWKEAIVLIWAGL
RGAVALSLSLSVAQVGQHDPTQNTYLSKLTEARF-VFFTGGVVLLTLIINGSTTQFLLLF
LKMDTITETKSRM-LEFAKYEMYSKALEAFGELGDD---EELG-PADWNT-IRK------
--YVSCLSYE----ENK----------PTH-----------PHGPPSFA--LPDG-----
---------------------------------------------EYAKQQ-MTDTRT-R
FLNGLQAAYWNMLDEGRITQTAALILMQSIDEALDKVKH-HT------------------
---------ALQDW-EGLRPHIH--FPGYLKYFS--------------------------
-------------------------------------------WRSTSV-LPRRA-----
------------------------------------------------------------
-------------------------------STYF-------------LIQQLELACYI-
-------AAAFLRAHRMT---RNHL-RDFIGESEVT------------------------
----------------EAVIQES---EAQAQHARLFLED-VRLSFPQVLRAVKAKQVTHA
ILL---HLTTYVESLENAGLFESKE-----------------AVHLHDAVQIDLKKLLRD
--PPI-------------------------------------------------------
------------------------------------------------------VEMPSA
EQTLQNQP---------------------------FI------GAMPTSVQK-----PLL
DVSKEYMKLQGSVIYREDMK-SDGIWLITNGVVKWSKK--------------A-VGGQRL
RQPT----------------------------FSFGSTLGLYEVL-TG-----KPYLCDV
--VADSVVH-CFFVERSRILFIQKE----RAD--LEDFLWQESALAVA-KIVLGPQFDMA
TLQDIR---ALV-M-EGSSMRIFLRGEVFELRHKEMGLL---------------------
--LEGFVRQENST-E-LITAP-AGL--TAK------ILL-PS--PTGS--WSNISLQQPT
VF-HAEARSRVLLFESSKV-GEILSQGSSQLLAVP-----RKT-SRSMLRLSSKTSTNTR
TKVDRHSSHNEIRIA-SDH--SIPIAQAWG-SGSSC-VPDKYTAKALEISVFGSEVDVR-
------DKR--------RADEIPLDAQSRFTQS----------------HSNLVKRV---
-------SLMMQERFDNKQTSMPKRKIASQEN----------------------MTVPMS
LLP---HQSEPKP-DDSSDDS-DKEEHIVR-IDSPSFLFHNS---------------RR-
---EL
>gi|109032998|ref|XP_001103513.1|	   1219 residues, 50 /line  PREDICTED: similar to sperm-specific sodium proton exchanger isoform 3 [Macaca mulatta]
------------------------------MDDDTDIVSDIN-------LQKNVSSTWLE
YFRS-LFFSA--------------------------------------------------
------------------------------------------------------------
------------PDDLPEIILTLSLIST-I------------------------------
------------------------------------------------------------
------------------------------------------------------GAFLNL
H--LKDFPIPLPVMLFLLGCGFEVL-SF-TSLR--VQRYANAIQ---WMSPDL-------
--------------LFCIFAPVIFFTTAFDMDTYMLQKLFWQILLITIPGFLVNYILVLW
YLAA-------VNKLH---LKPTPWLLFSAILVSS--DPMLTAAAVRD-LGL-SRSLISL
INGESLMTSVISLIIFTSIMDF--DK-----EQ-QNKRNHTIARYIVGEFFS---NIIAS
FLFGILSSKLIQFWMSTVFGDDVNHISLIFSILYLIFYICE-----LLGMSGIFTLAIVG
LLLNS---TSFKAGVE-ALLLEFWNFLSRVAFLMVFTFFGLLIPAHTYLY----------
------VKFADIYYSLNIYFTLIVLRLVTLLLMSPALSRV--G-HEFSWRWVFTMIWSET
KGMPNINMALLLAYSD------LYFGSDKEKSQI-LFHGVLVCLITLIVNRFVLPTAVTI
LGLRDATSTKYKS-VCCTFQHFQELTKSVASVLKFD---KDLA-NADWNM-IEK------
--AIILENPYMLNQEET----------TEQ------QKVKCPHC---NK--EIDE-----
---------------------------------------------ILNNEA-MELANR-R
LLSAQMASYQRQYRNEILSQSAVQVLVGAAGSFGEKKGK-CMRLETIKNYSESQK-----
--TITFTRKLLLNWVYNTRKEKV--GPSKYFFFHLCHTIVFTEEFEYVGYLVILMNIFPF
VISWISRLNA---------------------IYRRELKHTNYCFLTLYV-LEALLKIAAM
R---------KDFFSHTWNLFELAITLTGILYAILTEI----EA----------IKY-IF
AVTEIIVFIKLVQFIRILRIFKLIAPKVLQIIDKR-------------VSQQKTFWYGI-
-------LKGYVQGEADV---MTII-DQITSSKQIK------------------------
----------------QILLKRV---IRNMKHATKELGY-LEYDHPEIAVTVKTKEEINV
MLN---MAREILKAFGLKGIIHKIE-----------------SAQISKLIMAKKKEMLES
--KSI-------------------------------------------------------
------------------------------------------------------IRPLTV
EEVLYHIQ---------------------------WL------DK-NQDHIN-----FIQ
EKAKVVTFDCGNGIFEEGDE-PQGIYIIISGMVKLERSKPGLGIDQMV-ESKE-KDFLII
DTDY----------------------------MLSGEIIGEINCL-TN-----EPMKYSA
--TCETVVETCFIPKTHLYDAFKQC----SPL--IEHKMWLKIGLAITARKIREHLSYED
WNYKMQ---LKLSN-IYIEDIPMTTKTDIYDENVIYVIL---------------------
--IHGAVEDCQLRK---FYRA-PFL--IPIT------------------------CHQIQ
GI-EDFTKVVIIQTPTNMKA---------------FRWNIRKFIPKHKSSLT--------
--PGLMR---------STETLEA--------GIQGE-TKTNVK-----------------
-----------------------------EDGA----------------HSTATARSPQ-
-------PCSLLWTKFNCKKSL-------RINLGKSGK---------------SETVMKT
--------------------EACINTV---------------------------AMRGVL
----L
>gi|119879464|ref|XP_615728.3|	   1262 residues, 50 /line  PREDICTED: similar to sperm-specific sodium proton exchanger [Bos taurus]
--------------------------MGAGQGRGLEQVTVNE-------VAVGCGCFWMN
ELAT-FHLSLTYYIILLLK---LWMALRGNHTVAVANLRCMEQS----------------
------------------------------------------------------------
REQGRAHS-SEEILGRQQTAYFHSVYIF-F------------------------------
------------------------------------------------------------
------------------------------------------------------AALLNQ
H--LKDFPIPLPVILFLLGCSFEML-SF-TSDK--VQEYADAIQ---WMDSHL-------
--------------FFNLFTPVIIFSVAFDMDVYLLHKLFWQIVFITVPGFLINYTLILW
YLAS-------VNKLL---LKTTPWLLFSAILVSL--DPMLTSSAIKD-LGL-SRSLVSL
INGESLMTSVMSLITFTVIVNI--DL-----SL-HKNTIQSLAYIIMREIWL---HLIVS
FSFGIVSSKLIQLWMSTVFGEDVNHISLSFSFLYLIFYICE-----LTEMSGTFTLVIMG
LFLNS---TNFKPGVE-ALILEFWNCLSFVAFLMVFTFTGLLIPAHTYLY----------
------ISFSDIYYSLNIYLTLIMFRLLVFLLLSPLLSRL--G-HGFSWRWAFIMVWSEM
KGTPNINLALLLAYFE------NSYGSEREKSQI-LFHGVSVSLISLIVNRFILPMAVTK
LGLRDVTSTKYKS-LYYTFQHFQELTKSVASALKFD---RDLA-NADWNI-VEK------
--TIILQNPYALGQGET----------KEH------QKVKCQHC---NK--EIDD-----
---------------------------------------------NLNIEA-MELANR-R
LLSAQIASYQRQYRSETLSQSAIQVLVGAAGSFGEKMVE-YMNAETIKNYSESKK-----
--ILVFTRKVLLNWVYNTKKEKG--IPSRHCFLRACHKIVFTDEFEYIGYLVILMNMFPI
IISCISVLND---------------------IYETELAYANYSFLAFYI-MEALLKIAAM
R---------KEYFFHAWNLFELTITLVGIIDVMLIET----NS----------INYYIF
DLVQIVIIMKIVRFLRILRILKLVTPRLLQILDKR-------------MSHQLSFRYAI-
-------LKGYVQGEADI---MTII-DKIASSKQVK------------------------
----------------QMLLRRV---TKNTGHAMKELGY-LEYDHPEIAVTMKTKEEINV
MLS---LAREIVKVFRLKGILHKIE-----------------GSEINKIIMAKKRDILDF
--QPT-------------------------------------------------------
------------------------------------------------------YKPLTV
EEALYHIP---------------------------WL------DK-DEEHIS-----FIQ
ERSRVVTFDCGNDIFEEGDE-PKGIYVIISGMVKLQRSKPGLGIDQIIWESEE-KDYQIT
YTDF----------------------------VISGAVIGELNCL-TN-----APMKYSA
--TCKTVVETCFIPKNHLYEAFEQF----YPH--IEYRMWLKLGLSITAKKIREHLSYED
WNYKMQ---LKLSN-IYVKDIPKNTKTDIYDETVIYVIL---------------------
--IHGAVEDCQLRK---AYKA-PFL--IPIT------------------------CHQIQ
GT-EDFTKVTIVQTSIYSKR---------------FRWNTRKYIASHKPADP--------
--TTSGA---------ESRRCEY--------PFPEE-TRTQFEAG---------------
-----------------------------ESGT----------------RENLSQEETH-
-------TQNQEPTKSTAKIMM-------DKSIYGNAS---------------NKPKRKS
--------------------EMFDKAV---------------------------------
-----
>gi|34535281|dbj|BAC87265.1|	   1177 residues, 50 /line  unnamed protein product [Homo sapiens]
---------------------------------------------------------MAG
IFKE-FFFST--------------------------------------------------
------------------------------------------------------------
-------------EDLPEVILTLSLISS-I------------------------------
------------------------------------------------------------
------------------------------------------------------GAFLNR
H--LEDFPIPVPVILFLLGCSFEVL-SF-TSSQ--VQRYANAIQ---WISPDL-------
--------------FFRIFTPVVFFTTAFDMDTYMLQKLFWQILLISIPGFLVNYILVLW
HLAS-------VNQLL---LKPTQWLLFSAILVSS--DPMLTAAAVRD-LGL-SRSLISL
INGESLMTSVISLITFTSIMDF--DQ-----RL-QSKRNHTLAEEIVGGICS---YIIAS
FLFGILSSKLIQFWMSTVFGDDVNHISLIFSILYLIFYICE-----LVGMSGIFTLAIVG
LLLNS---TSFKAAVEETLLLEFWTFLSRIAFLMVFTFFGLLIPAHTYLY----------
------IEFVDIYYSLNIYLTLIVLRFLTLLLMSPVLSRV--G-HEFSWRWVFIMVCSEM
KGMPNINMALLLAYSD------LYFGSDKEKSQI-LFHGVLVCLITLVVNRFILPVAVAI
LGLRDATSTKYKS-VCCTFQHFQELTKSAASALKFD---KDLA-NADWNM-IEK------
--AITLENPYMLNEEET----------TEH------QKVKCPHC---NK--EIDE-----
---------------------------------------------IFNTEA-MELANR-R
LLSAQIASYQRQYRNEILSQSAVQVLVGAAESFGEKKGK-CMSLDTIKNYSESQK-----
--TVTFARKLLLNWVYNTRKEKE--GPSKYFFFRICHTIVFTEEFEHVGYLVILMNIFPF
IISWISQLNV---------------------IYHSELKHTNYCFLTLYI-LEALLKIAAM
R---------KDFFSHAWNIFELAITLIGILHVILIEI----DT----------IKY-IF
NEIEVIVFIKVVQFFRILRIFKLIAPKLLKIIDKR-------------MSHQKTFWYGI-
-------LKGYVQGEADI---MTII-DQITISKQIK------------------------
----------------QMLLKQV---IRNMDHATKELGY-LEYDHPEIAVTVKTKEEINV
MLN---MATEILKAFSLKGIISKTE-----------------GAGINKLIMAKKKEVLDS
--QSI-------------------------------------------------------
------------------------------------------------------IRPLTV
EEVLYHIP---------------------------WL------DK-NKDYIN-----FIQ
EKAKVVTFDCGNDIFEEGDE-PKGIYIIISGMVKLEKSKPGLGIDQMV-ESKE-KDFPII
DTDY----------------------------MLSGEIIGEINCL-TN-----EPMKYSA
--TCKTVVETCFIPKTHLYDAFEQC----SPL--IKQKMWLKLGLAITARKIREHLSYED
WNYNMQ---LKLSN-IYVVDIPMSTKTDIYDENLIYVIL---------------------
--IHGAVEDCLLRK---TYRA-PFL--IPIT------------------------CHQIQ
SI-EDFTKVVIIQTPINMKT---------------FRRNIRKFVPKHKSYLT--------
--PGLIG---------SVGTLEE--------GIQEE---RNVK-----------------
-----------------------------EDGA----------------HSAATARSPQ-
-------PCSLLGTKFNCKESP-------RINLRKVRK----------------------
------------------------------------------------------------
----E
>gi|37674259|ref|NP_932774.1|	   1120 residues, 50 /line  solute carrier family 9, isoform 10 [Mus musculus]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
H--LKDFPIPLPVILFLIGCCFEIL-SF-ASTQ--IQIYADAIQ---WMDPDI-------
--------------FFGIFTPVIIFNVAFDMDIYMLQKLFWQILVITIPGFLINYTLILW
YLQS-------VNKLS---LKTVPWLLFSAVLISS--DPMLTSASIRD-LGL-SRSLTNL
INGESLLTSVLSLVIYSGVVHI--RF-----KS-K-SVNHTLAHKVMSTAWS---YIVES
FITGIVFTKVIQLWMATIFGDDVNHITLIFSVLYLIFYVCE-----LVGMSGIFTLATIG
LFLNS---TSFKPGVE-AFLLEFWNCLSFIGFLMVFTFIGLLIPAHTYLH----------
------ISFSDVYYSLNIYFTLIVLRLLVFLLMSPILSRL--G-HGFSWRWAFIMVWSEM
KGTPNINMALLLAYSD------ISLGSERERSQI-LFHGVSVCVITLIVNRFILPMAVTK
LGLRDVTSTKYKS-VYYTFQHFQELTKSTAMALKFD---KDLA-NADWNM-VDN------
--AIILQNPYALNQEEI----------TEH------QKVKCPDC---TK--EIDE-----
---------------------------------------------TLNIEA-MELTNR-R
LLSAQIASYQRQYRNEVLSQSAVQVLVGAAGSFGEKKGE-YMSPENIKNFSESKK-----
--LLSFLRKLLLNWVYNTKKDKG--VPSRYMFLHACHRIVFTNEFEYTGYLVVLMSTYPM
IICWISRLKD---------------------IYDNEIKCANYYFLAFYI-LEALLKVAAM
R---------KEFFSHTWLLFELGITLVGILDIILIET----DS----------ISY-NF
DLTETVVFMNVIRLLRILRILKLVTPKLLQIIDKR-------------MSQQISFRYSI-
-------LKGYVQGEMDV---LNII-DQIASSKQTK------------------------
----------------QILLKRV---MRNMEHAMKELGY-LEYDHPEIAVTMKTKEEINV
MLN---MAREIVKTFRSKGIIHKVE-----------------GTEINKLIMAKKIQVLDL
--QSV-------------------------------------------------------
------------------------------------------------------IQPFNV
EEAPCNIP---------------------------WL------SE-DPEAIT-----FIQ
EKAKVVTFDCGNNIFEEGDE-PEGIYVIISGMVKLKRSKPHLEMERVSAESEI-KIHPLP
HTEY----------------------------LLSGEIIGELNCL-TK-----ERMQYSA
--TCKTVVETYFIPISHLYEGFEKR----CPN--MKHKMWQKIGLAITAQKIREHLSFED
WNYKLQ---LKLCN-AFIRDIPKSMKTDIYDETVTHVVL---------------------
--IHGSAEDCQLRK---IYKA-PFL--IPVT------------------------CHQIQ
GM-EDFTKVMIIQTSIAVRK---------------FRWNVRKFIPPRRISMK--------
--PDSER--------ESFETLDE--------TSEED------------------------
------------------------------NGK----------------KENQENEELI-
------------------------------------------------------------
-------------------------------------------------------EENIN
----I
>gi|74002660|ref|XP_535739.2|	   1227 residues, 50 /line  PREDICTED: similar to sperm-specific sodium proton exchanger [Canis familiaris]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------MYF-F------------------------------
------------------------------------------------------------
------------------------------------------------------AAFLNL
H--LKDFPIPLPVILFLIGCSFEIL-SF-TSEQ--VQAYADAIQ---WMSPKL-------
--------------VFDMFTPIIIFNVAFDMDVYMLQKLFWQILLITIPGFLMNYTFILW
YLAS-------ANKLF---LKNTPWLLFSAILVSS--DPMLTAAAIRD-LGL-SRSLVNL
INGESLMTSIMSLIIFSGIEEI--NV-----NL-QK-KNHSITLDILLELWF---YFLAS
FLFGILSSKLIQLWMSTVFGEDVNHISLSSSILYFIFFICE-----IVGMSGIFTLAIMG
LFLNS---TSFKPGVE-VLLLEFWNCLSFVAFLMVFTFIGLLIPAHTYLY----------
------VSFYDIYYSLNIYFTLIVLRLLVFLLLSPLLSRF--G-HGFSWRWAFIMVWSEM
KGTPNINMALLLAYSD------LSFGSEREKSQI-LFHGVSVCLVTLIVNRFILPIAVSK
LGLHDVTSTKYKS-LHCTFQHFQELTKSAASALKFD---KDLA-NADWNM-VEK------
--AIRLQNPYALSQGDT----------TEH------QKVKCLDC---NR--EIDE-----
---------------------------------------------TLNIEA-MELANR-R
LLSAQIASYQRQYRNETLSQSAAQVLVGAAGSFGEKKEK-YMSPETIKHYSESKK-----
--LLAFIRKVLLNWVYNTKKEKG--IPSRYYFLRVCHKIVFTDEFEYVGYLVTLMNMFPI
IISWIPKLSD---------------------IYEHELRHSNYSFLVLYI-MEALLKMAAM
R---------KEYFLHAWNVFELVITLVGIIDIILIET----NS----------ITY-TF
DFILTVVFIKIVRFLRILRILKLITPKLLQIIDQK-------------MSHQQSFQYAI-
-------LKGYVQGEADI---MTII-DQISTSKHVK------------------------
----------------QVLLRRI---TKNTGNAMKELGY-LEYDHPEIAVTMKTKEEINV
MLN---LAREIVRVFKSKGIIHKIE-----------------STEINKLIMAKKKEILDF
--QPV-------------------------------------------------------
------------------------------------------------------IKPLTV
VEALHHIP---------------------------WL------DK-DKEYIT-----FIQ
KRARIVTFDCGNDIFEEGDE-PKGIYIIISGMVKLQRSKPSFGIDQM--ESEE-KDYQMN
YTDF----------------------------LISGEIIGELNCL-TN-----KPMTYSA
--TCKTVVETCFIPKNYLYEAFEQC----SPH--IEYKMWLKLGLSITAKKIREHLSYED
WNYKMQ---LKLCN-VSVKDIPKNIKTGIYDETVIYVIL---------------------
--IHGAVEDCQLRK---AYKA-PSL--IPIT------------------------CYQVQ
GT-EDFTKVMIVQTSVDLKN---------------FRWNTRKYVPSRKPSLPTCGSRTLK
KYPGLRKIKAANREHPGKEMSSA--------PTQDS-ADQSSS-----------------
-----------------------------EDLC----------------YTLINHSVLG-
-------GKSSGISAERCYENISPKTETPRESLGKTEV---------------SYALLRV
----------PSSPRHSSSPEDAYELIIPRRVFSYSLQQPHP------------PTPHLE
NRVSY
>gi|118397161|ref|XP_001030915.1|	   1148 residues, 50 /line  Sodium/hydrogen exchanger family protein [Tetrahymena thermophila SB210]
---------------------MKSTTYRLLLT---GIVALSI-------FLQ--------
------------TVLATLE---NGQQQNSNQTNSSESFQQKESSQDDMNSII--------
---------------------------------------------------------KKV
KDSSIVKP-EEHIVKESRIIFFIFMSLT-I------------------------------
------------------------------------------------------------
------------------------------------------------------GGLLKH
V--NKRFPVAYTSMLFLIGYFGGLF-H----DS--LGQLGESIKSASSINPVFTYKLQIQ
SKFQSVLYSKQKHGILIIFLPVMIFQSAYNTDWHIFRRQFSQIFILAVPCVIVGSVLIMA
FIKL-------LYRGD--EYSLSSTFLLGSLLSWT--DTVAIGAILQE-IGA-PKRLNSL
IKGESLMNDITCVALYKVVKEV--VR-----ES-IT-----GFWGSVQYFFV---VALGG
ILFGILFGFVTSFWIKKIFNDEIHAVNIVLLSCYLLYFFGQNITIFGQSLNGIVPLVSFG
LFMSASGKKRIASQAD-QAFRQFWNYISFCAETVIFILAGVIVSFTFYSEETS-G-----
------ITTPDYYKLFLIYIFTIISRLASISMFMHFLQRL--G-YGLTWHEVYVLAYGGL
KGAIGVSIALIVSHD--------QHFNSEMRALI-LFEVAGNCLLTLLINGSTIKFLIQY
LKITPTSQLKDKLFMDYLEKDFKEELEQQVKELKES---KYLK-NADWDNDVLVLS----
--GAKKQQEYMLQLDKK----------IQE------KEQNQEDN-----KKKEENELQVV
LLKDEKKYQENDRVDEENKQEDKPRQERSNSNSSDSSDEDNENSIKQDDET-LIFIRN-I
FLKRLKSAIWDLFEKNQCTGESYIRLCEAVDWDLDLET--S-------------------
---------LMNNW-TYLKRQFSEGYIHFYSTL---------------------------
---------------------------------------------RNWT-IIGNW-----
------------------------------------------------------------
-------------------------------AKKQ-------------LFQHISGIFDM-
-------VHTYLEAHKIA---MTNL-----------------------------------
-------------------LSEA---QENEIYAKQYLDDFLDISFPDVSQQIRTKKVAFT
ILE---YQKDIIKEKSAQGQLDEKE-----------------FFSLKKKIDQNIIQINNL
--TPS-------------------------------------------------------
------------------------------------------------------WNELKF
DDFIKSQP---------------------------LF------QLLSQHMKEKAKFSEII
SQATEARFDPEQFVFKSEKK-ATHIFVIMRGGGTESYK--------------N-DLGKFS
VKRG----------------------------VGH--ILPIQQLLNSN-----NKYQTEF
--QADCMMI-TRQIEIKKIQDHIKC----HHE--IEHHIYRESLPYLF-KIHYQQF-APL
SVLDIE---KIEDI-INKTFVRRIKKDTI-FEMQSGGIL---------------------
--ARGEVQLVLNEI-------------------GQSSLNVFEDDQNNVV-KKRE------
--------------------SSEVNIQEQDARLRPNF-------QSEQD--------QMP
EKV-----------------------ITAY-SIINP-NASYYTYKTTKKSIIFEFTNP--
-------------------------------EE----------------IRLLTTALRR-
-------QRATLITPNSALRNLLKK-----------------------------------
------------------------------------------------------------
---YN
>gi|118589284|ref|ZP_01546690.1|	   994 residues, 50 /line  putative Na+/H+ antiporter with cyclic nucleotide-binding domain [Stappia aggregata IAM 12614]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------M-ETPLITGAFALLLITISLL-Q------------------------------
------------------------------------------------------------
------------------------------------------------------PLARRL
G--LAPSVLLATVGTM-IGILATYL-RYTAETN--AFNAIADVFINPPLDSEM-------
--------------ILYIFLPILLFQTALTLDVRRIIEDIAPILLMAVVAVLLHGFIGFA
LYPL-------ATLFS---LTDITLIAASARLHRRHHGPGRVVAIFRD-IGA-PARLGRI
VEGESLLNDAAAIVIFVILLHM--LT-----GHETM-----TVGESAIAFSR---SFAGG
IIVGALLGRIAVSLLPVMRDIPLAQVTLSLALPYGTYVLSDQ----FVDVSAVVAVVCAG
TVFNLYGPARIQPASW-QFLHAVWEQISFWAASLIFLLSAILIPRFVEGF----------
-------TPIDILLLFVVIVAALAARAVVIFGLLPVLSVFRMG-QAVNDRYKTVILWGGM
RGAVTLTLALSVSE--------HAMLSDEVSVFV-TKLATGFVLFTLLVYGTSLKPLIRL
LGLDKLNARDEALR---TQYLAL-----ALSDVRQE---LETAA-RNYHI-APRV-----
--TDDVLKDY----ETR----------AAA-----------AAAET-----NKLE-----
---------------------------------------------ELKDWDRVRIGLI-A
LADREQQLVLEHFHDKTISGRSVSRFLAMTGRTGDLTRS-E-------------------
---------GRSGYNQAARQPLK--FGLGFRLA---------------------------
---------------------------------------------QTLQ-RRLRI-----
------------------------------------------------------------
-------------------------------ARPL-------------AIRLADRFEFL-
-------LVYRILADELVDFNNRRI-RPLLGD-RVA------------------------
----------------DILQDTL---AIRQDETLAAIDA-LRLQYPDYADALEGQFLRKA
GVRL--EETAYDEAKEQMLIGTELH-----------------RELLRDAERTR-KACHTR
--PKL-------------------------------------------------------
------------------------------------------------------DLGLKT
RELVSAHP---------------------------LF------ADLTRKQQK-----AIR
RMMRPQFATPGEKLIRKGDR-GDAAYFIASGAVEVRAP--------------S-HNIR--
--------------------------------LGRGDVFGEIALM-TG-----GRRSADV
--VALGYCQ-LLSLRAQDFKALLGE----NED--LRNH----------------------
----VA---MLT-K-RRQLMNMDDGEAELEDPV----FP---------------------
--IFSEIRTSTRSE------------------------------EAPD--PEAGPSEQET
N----ETEAEVFTFDETDA-QNDPSLTEKLNA----------------------------
----ADTVTKTVEETPL--------PDNERDSDANE-SEGKAAAKEKSESNTGSADEKE-
------------------------------------------------------------
----------------------------EKGGAE-------------------GAQPRMT
TSAA---TSSPDEDKTEPAEEVRARSMPEK-TQEPNAKSHET------------------
----A
>gi|118791508|ref|XP_552951.2|	   1222 residues, 50 /line  ENSANGP00000028764 [Anopheles gambiae str. PEST]
-----------MAVMLKQEVNLSRRACR--------------------------------
------PTTTNNDDCLQEQRTLLTTPTEGGSWHNDTCYGGGGANSRLVTVPAPAKELTDS
SRSGGLPSSSSS---------------SSLSC-LLATIVMWCTGQVLLKLR---------
--QAGQGG-WREVQQPPRLSRLCIYVVF-CSALL-SHNAFVLARPN----LSAPASGEKV
PVGQ---LSPLDLAFDASSGSLTSASQLKRSAEAAAIIASTAPSADGGAGHEAEDTALGH
GRVGEGEGGEHGGEHVVER-------YPVSQVDFSRVETPFVIGVWILSASIAKIGFHMT
P--KLSRIFPESCLLIVVGVIIGVLLRYATNLH--V----------SPLTPNT-------
--------------FFFYMLPPIILDAGYFMPNRMFFDNIGTILLMAVIGTIFNIATIGG
SLWACGQTG--IFGVD---LPFLHIFLFSSLIAAV--DPVAVLAVFEE-IHV-NEVLYIV
VFGESLLNDAVTVVMYHMFEVYNEIG-----AS-EI-----IAVDIVSGIASFFVVALGG
TIIGVIWGFLTGLVTRFTDHVRVIEPIFIFVMAYLAYLNAE-----IFHMSGILAITFCG
ITMKNYVEQNVSHKSH-TTIKYALKMLSSSAETIIFMFLGVATVN----NKHVW------
---------NTW-FVLLTIIFCSVYRILGVLILSALANRF--RIHKLTKVDQFVMSYGGL
RGAVAFALVLLVDVNH--IP---------LQPMF-LTTTIAVVYFTVFLQGITIKPLVKI
LNVKRSSKRKPTM-NERIHERFMDHMMAGIEDIVG-------------------------
-------------------------------------------------------KTGNY
NIRDKFK--------------------------------------RFDNRF-IRPLLI-K
NLQG---------PEPKILETYSKLTMR---DAMDYMRR-NP------------------
--------STIGQM-SGTESM-SALFRNY--------TSYFGGSPSFTNLENSTRNLDMQ
ELDYNPSKKD---------------------LTDAKIHHL----LSEEL-KPYRR-----
------------------------------------------------------------
-------------------------------HRRL-------------SYSR--------
--------------HAVDDRDLSTQ-VNYKMQMNIR------------------------
----------------RMISEKKH--HKRSKRVKDGKQQ-NHVSFPEFVQNGSAKQFAND
YINEVLHEDNEDEERQAAGPSEDWDGGGLTFTAKSSLDERGAA-KEDKRFSRESRFLES-
--EQR-------------------------------------------------------
------------------------------------------------------VATPTA
IESVLPWK---------------------------RV------DE-------SDDNGAIK
QNEFPSWASNKEYLAYNSPS-ATF----LGGLTQPKQAKSVIGLFR--------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------RESSGSGGVV---------------------
--IGGVTDSE--------------------------------------------------
-----TSTPVAATTPVGRM-AAVPKDKR------------------------------SA
SIAGYITIDGGDTAGNPMLDPLGISRAG-PHATAFP-----VTASHRRNNRRGSMLELSG
EAIPEENYTKSLPERDKYGARRAPALIKASSTN----------------TPKSAGRRSGG
GGGPVNPQTTALLSASSTDSDEDDEEEGSGDR----------------------HRADDA
TRRLNGAGNNDDEDEDDDEDDDDEDEDCAD------------------------------
EQHPI
>gi|32450774|gb|AAM63432.1|	   1179 residues, 50 /line  Na+/H+ exchanger [Aedes aegypti]
----------MVAHSLQQEVNLSRRACRIPKW---------------------------P
LSGA-QQEEENDEEVLEEQ---LLNGANQSPASEVAAFRLGPVHSENSPGGIDEDPLSFR
NRRMHDGRMGSV---------------VDFSCDLVARVFLLVKALVMGVLRFDLTSPKRA
SSSSSNSS-SYGSQFSKNLVKWCTWAIV-LSVVLANHGGFVLARPKNGVVTADGVDAASV
ASGQWELLTPQPVSSDGAGGGQISGS-----------LSSVKQQDDQSHGGEL-------
------GDASHGEGHEVER-------YPVAQVEFSRVETPFVIGVWILSASIAKIGFHMT
P--KLSKIFPESCLLIVVGVIIGVLLRYTTNLH--V----------SPLTPNT-------
--------------FFFYMLPPIILDAGYFMPNRMFFDNIGTILLMAVIGTIFNIATIGV
SLWACGLTG--IFGVD---LPFLHVFLFSSLISAV--DPVAVLAVFEE-IHV-NEVLYIV
VFGESLLNDAVTVVMYHMFESYNEIG-----AS-NI-----QVVDIVSGVASFFVVALGG
TIIGVIWGFLTGLVTRFTDHVRVIEPIFIFAMAYLAYLNAE-----IFHMSGILAITFCG
ITMKNYVEQNVSHKSH-TTIKYALKMLSSSAETIIFMFLGVATVN----NRHIW------
---------NTW-FVILTIVFCSVFRIIGVLILSAMANRF--RIHKLSKVDQFVMSYGGL
RGAVAFALVLLVSTDH--IP---------LQPMF-VTTTIAVIYFTVFLQGITIKPLVRV
LNVKRANKRKPTM-NERIHERFMDHTMAGIEDIVG-------------------------
-------------------------------------------------------KTGNY
NIRDKFK--------------------------------------RFDNRF-IRPYLI-K
NLQG---------PEPKILETYSKLTMR---DAMDYMRR-NP------------------
--------STIGQM-SGTESM-SALFRNY--------TGVFGGSPSFSNLENSTRNLDMQ
ELDYNPSKKD---------------------LTDARIHHL----LSVEL-KPYRR-----
------------------------------------------------------------
-------------------------------TRRL-------------SYSR--------
--------------HAVDDRDLSTQ-VNYKMQMNIR------------------------
----------------RMISEKK---HKRSKRGKDGKTQ-NHVSFPELPQNGSAKQFAND
YINEVLHEDNEDEDKLPTAAGDDWDGGGLTFTAKSSLDEKSEQPKNDKRMSKDLRDLEAA
--ENR-------------------------------------------------------
------------------------------------------------------VTTPTA
IEAVLPWK---------------------------RV------DE-------DDENGAIK
QNEFPSWASNKEYLAYNSPS-ATF----LGGLTQPKQAKSVIGLFR--------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------RESSGSGGIV---------------------
--IGGVTDSE--------------------------------------------------
-----TSTPVTATTPIGR----VKKDKR------------------------------SA
SIAGYITFPGSSDAGD---DPLGVSRAVVSHANAFP-----VTASHRRNNRRGSLLELSG
EAIPEENYSKSLPDRDKHGPRRGPTLIKASGTP----------------KPARNSK----
---SNNPQTTALLSSSSTDSEEEEEE----------------------------------
------------------------DEDCTD------------------------------
EQHPI
>gi|66518336|ref|XP_391857.2|	   1107 residues, 50 /line  PREDICTED: similar to Nhe2 CG9256-PA, isoform A [Apis mellifera]
-------------------MYLAGRLCVVFALYP-------------------------P
ASSP-NDLQEDRRMKLWEQPCREPNALKGSSWL--------EVSSDGTEG--DSAPVDER
ERAARSPRSAPQ---------------SPCHV--VMATRAVTSTMIAFVLILLV------
-------A-GWPTGGQTGLVKF--YESV-PDHLQPDRRIPINDYAMHGPIVDD-------
HELPRDLREPYPGKSFGP-MGPIDGS----------------------LPDDVSFRSLSS
GQEKGANSIELLSSHAVEKVEKHKPEYKIMSVEFHRVETPFVIGIWIFFASIAKIGFHMT
P--KLSKIFPESCLLIVVGVVVGVLLFQASSVH--V----------SPLTPDT-------
--------------FFLYMLPPIILDAGYFMPNRLFFDHLGTILLFAVVGTIFNTLSIGA
SLWVLGKSG--LFGFE---TPLLQMFLFSALISAV--DPVAVLAVFEE-IHV-NEILYIV
VFGESLLNDAVTVVLYHMFEAYNEIG-----PT-EI-----LYTDVLSGLASFFVVAIGG
TIIGVIWGFGTGFVTRFTHQVRVIEPIFIFVMAYLAYLNAE-----IFHMSSILAITFCG
ITMKNYVEANISHKSH-TTVKYTMKMLSSSSETIIFMFLGVATVN----NHHDW------
---------NTW-FVVMTIVFCSIYRIVGVIFLTALANQF--RLHKLNKVEKFVMSYGGL
RGAVAFALVLLIDPKH--VS---------LQPMF-VTTTIAVIYFTVFIQGITIKPLVKI
LNVKRAEKKKPTM-NERIHERIIDHVMAGIEDILG-------------------------
-------------------------------------------------------KHGNY
HVRDKFK--------------------------------------RFDNKF-IRPYLV-R
NHYG---------AEPKILETYSKLAMK---DALDYIRR-NA------------------
--------STIGNI-SGTESM-SAIFRNYSN------TGQFNGSPSCSQLE-AGWNIDLQ
ELEYNPSKKD---------------------LTDARIHHL----LAEELCKPYKR-----
------------------------------------------------------------
-------------------------------HRRL-------------SYSR--------
--------------HAVNDRDLSTQ-VNYKMHMNIR------------------------
----------------RMMGEHKH-RHKRSKKLLKDGKQ-NHVSFPEFQQNGSTKLFTQD
YINGVLYEL-ENGDTSKPSSKEDWD-SAITFTARTSAAGKDNSGVSCRSVSLNVKRDERE
--SYR-------------------------------------------------------
------------------------------------------------------VTTPTA
TETMLPWK---------------------------RE------DD-------YDSGHPIK
QNEFPAWCSNKEYLAYSSPS-ATF----LGGIEQPK-VQSVIGLFR--------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------RESVCTPDGI---------------------
--DCQET-----------------------------------------------------
------------------------VDER------------------------------DE
-----YTLTGTEQTED---SPTKTFSEYEKDNKKGP-------------TRRVSMMELGS
---MEKSHSDKCTDDGSHSLPECWNAQRVRMTS----------------FPYSA------
---QVPSLSTALITSSSESSEEIDEEEE--------------------------------
------------------------------------------------------------
---KA
>gi|119924122|ref|XP_001255172.1|	   1267 residues, 50 /line  PREDICTED: similar to Solute carrier family 9, member 11 [Bos taurus]
MNGRFEAVIDKTVQLQKLFIFHEKGRMTEAGAEGQENILLSA-------CRVKNEWLETH
LEAS-INELFEQKQQLEDIVTPI---------------FTKMATPPLAEGIAGFESLENL
VWEQGCPDKLSRGCEGAEDVRLVCTSESVNSKSHPGSSTGTDKTMSKTNVSFWVQKEGNR
PDLLCGRA-ADYTVGKGHFLILVWSTLV-L------------------------------
------------------------------------------------------------
------------------------------------------------------GGLLRA
F--LKNSEVIVLTILSLFGFLIGQL-AYN------FVEMHQVIYPLLRTSSFS-------
--------------LYCYFSPLIIFMAALDVDFYILKNVFWQVFLTGLISFATTFIIIGY
VVLK-------FNKYS---WDLQSCLLFSMALGIT--DPIYSVNSLKT-VGI-SKMYTDI
IRGESMIICGFTSIFFAIFKTG--IL-----QMSNF-----RELHVIMGLTL---DILGS
IACGYWCARIIQFILTDLFSNTLTNIIFCISMVYMTFYIVE-----FWGMSGTVALATVG
LNLD---SLSFKPRIK-LIITKFLIMFSCIFQHLIYTFFGIVIGCGEVKY----------
------FQFHTVVFMFILFVTVNFVRFVTVVLVSPILMHS--S-YEYNWRWGIVIAWSGI
KGVFSLLFAPEVHNLAE--------QRVESPQLF-ILYIQVISLMTLGINSYVMTRLAKT
LDLCVLSIPRQMA-MQNAIKHIQEMIQSRITLFKTE---KLLT-NVNWTL-VEE------
--KTKIEY--IIPTP--HV--------SSD------SKAKE------------EF-----
---------------------------------------------PTDEVL-IEEARL-H
VAIIQISSFEKQCNDGVLSVEAARTLIGATKSYCHIQGK-FMSIYDVSTYVRARS-----
--WLVKFKNMLTFLEYHKDKTPL-FLYGHNKFLIFIYHIVFSEEFENAEHIIGIMYIYPM
IMHLWPTARK---------------------LNVSGLIFVNYYFVFLYL-LESALKIIIL
K---------RKYFHQHWNTLEFFIVLIGIVDIFCIYF----VR----------LRPDNL
ILIQFTVIIGYLRIIRFLPLLKIIIPLLINIVDVQ-------------IKKRLSLTYSI-
-------TKGYVKSLEDT---KFLI-RQISSRKSID------------------------
----------------QKLYEIL---ETNKRDAVKELGL-IEHEGRDVVIALKTKQAIRN
VIA---KALKSLTFLSSRGIIDKYE-----------------SVEMNKVLLEKIKSLNNF
--PMA-------------------------------------------------------
------------------------------------------------------IPLPTP
DKYLHNII---------------------------WL------EN-KDVLIE-----FFK
ERAKLAYFDYGDVICKEGEM-PQGIYLIISGMAILESSPPTFGIDRSL--RPD-RESTTR
FTEY----------------------------CTSGDIIGELSCL-LK-----REIEYTA
--ICETILQVCFISLEDLYEGFDFF----WPS--LEYKIWLKLALSIAYQYFESSLVDED
LKFQKC---VMLNH-AYVETLSSYNEMIIDNVNMKFVIL---------------------
--VYGSVIDTKTEV---PYFA-PCI--LPKT------------------------CEQVQ
GT-SDLSKLLVIQAPAPDKN----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------DGNAKVMGNTGLGMTKRNYQWKK-------------------
---KD
>gi|73961353|ref|XP_537189.2|	   1128 residues, 50 /line  PREDICTED: similar to sperm-specific sodium proton exchanger [Canis familiaris]
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MSNTNSSFWVHKEGHK
PELLCGSS-ASYTVVNGHFIMLVCSTII-L------------------------------
------------------------------------------------------------
------------------------------------------------------GGFLKT
L--LKNSEVTVLMILSLLGFVIGQL-AHN------SIEVHKIVYPLLKTPSYS-------
--------------LYCYFSPMIIFMAALDVDFCILKNVFWQVLLIGLVSLLMTFIILGY
VVLK-------FNKDL---WDLQSSILFSMIVGMT--DPVHSVNSLKT-IGI-SKTYTDI
IRGESMIICGFTSICFGVFRSD--FL-----HISMF-----TEFRVILGLCL---DILGS
IICGYSCSRIIQFILTDLFSNTLTSIILCISMVYMTFYIGE-----SFGMSGMIALVTVG
LNFD---SLSFKPRIE-VTITKFLIMFSSVYQQLIYTFFGIVIGCGETKY----------
------LRFHTVVFMLILFATVNFVRLLTIVLVSPLLTHA--N-YEYNWRWGIVIAWSGI
KGIFSLLLAPDIHNLAD--------QKVESPQLF-ILYVQGISLMTMGINSYMMAHSART
LGLCATSLPRQMA-IQNAIKHIQEIIQNTITLFKTE---KVLT-NVNWTL-VEE------
--KTKIEY--IIPSDAYNN--------VSH------DDIEE------------ES-----
---------------------------------------------LTEEVL-IEEARL-H
VAIIQMSSFEKQCNDGILSVEAARILISATKSFCPIQGK-FMSIYDVSTYVRARS-----
--WLIKFKNMLTSLEYHKDKALF-ILYGDNKFLLFVCHVVFSEEFEYAGHIITVMYIYPM
IMHLWPMARE---------------------LNVSGLISVNNYFVFLYI-FQAAMKIISL
K---------RKYFHQYWNTLEFLIMLVGIIDIFCIYF----VK----------LRPDNF
ALIQMTVILGYFRIIRFIPFIKLIIPLLINIVDVQ-------------IKKRLRLMYSI-
-------TKGYVKSQEDT---KLLI-KQISSRESVY------------------------
----------------QKLYEIL---ETNKRDAVKELGL-IEHEGRDVVIALKTRQAIRR
VIA---KALKNLTFLWSRGIIDKHE-----------------GIEMNKVFLAKIKALNNF
--PMA-------------------------------------------------------
------------------------------------------------------IPPPTP
DKYLHNIV---------------------------WL------EN-KDVLIE-----FFK
ERAKLAYFDYGDVICREGEM-PQGIYLIISGMAILHSSPPTFGIDSSL--RSE-RGSKSM
FTEY----------------------------CTSGDIIGELSCL-LK-----RETEYTA
--ICETILQACFISLEDLYEGFDVF----WPS--LEYKIWLKFALSVAYQYFESSLIDED
LEFQKC---VTFNL-AYVETLSSYNEMTIDNVTMKFVII---------------------
--VYGSVIDTKTEV---PYLA-PCI--LPKT------------------------CEQIQ
GT-SDLSKLLVVQPSDPAKN----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDDPKVMECAFSEDLWCPRVYGA-------------------
---TA
>gi|125821741|ref|XP_001345326.1|	   960 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
----------MRGLSLLLFITLARDAVTDL------------------------------
----------------------YVTGASLPPKL---------------------------
------------GVSAAPPATS--------------------------------------
-----------------------------------------------------PVAARYI
---PREYGHPGIALARSA------------------EEPTTP------------------
------------STEDGESSHHHGGGFKIVQWEWSYVQTPYIIASWLLVASVAKILFHFS
Q--RFTTAVPESCMLILLGLALGTVV------------LLASKKQPYQLDPGL-------
--------------FFLFLLPTIVGDAGYFMPARLFFDNLGAILMYAVVGTLWNAFCTGF
CLYGVKMAGVIDEKVD---AGLMEFLLFGALISAV--DPVAVLAVFEE-VHV-NETLFII
VFGESLLNDAVTVVLYKVYISFVEVG-----PG-NV-----NTADYFKGIASFLIVSIGG
TLVGLIFAVILAFFTRFTKKVRIIEPMFIFLLVYLAYLTAE-----LFSLSAILSLTFCG
IGCNKYVEANISQKSR-TTVKYTMKTLASIAETIIFIFLGISAVDK--------S-----
------KWAWDTGLVVSTLIFILVFRAMGVIGQTWFLNWF--RLVPLDKIDQVVMSYGGL
RGAVAFALVVLLDKEH--VK---------AKDYF-VATTIVVVFFTVMFQGLTIKPLVKW
LKVPRSTNRKPTI-NEEIHERAFDHILAAVEDIAG-------------------------
-------------------------------------------------------LNGYH
HWRDKWE--------------------------------------QFDKNY-LSKLLL-R
KSVYHKSELWEAYQKINIR------------DAISVIDQ-GG------------------
-----NVLTSARVSLPSMASRTS--FPEVTN------------VTNYLRENGSGVCLDLQ
VIDTVPGAKI---------------------EEELETHHV----LAGNLYKPRR------
------------------------------------------------------------
-------------------------------RYQS-------------HYSR--------
--------------HFMTLGEKERQ-DREVFQRNMR------------------------
----------------NRLESFKSTRYKRHKKDRNAKEQ-DTSDKP---RRNVSWQDKDP
LVAPLATEEDKHD----PTEVDKDDDVGIIFVARRTPETPKE------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------RPKSAALDVCQSPIT-A-----
---------------------------------PPSLTCGEKNLP-WK-----SGMGSLP
--P-------CVSVEATKIIPVD-------------------------------------
--------------------------------------L---------------------
--QQAWNQSISSLES-LASPP-APA--EPLHPRISALSR---------------------
--------------------------LGGPLRTPAKDKSAGVDAGLEST--------TSS
PSSGQFKYPMGKEE-----------------------------------EEEGALSQQHR
EMQPLMSSLRPPP-----------------------------------------------
--------PPPPLAAQSAGKRRNPCVYLRSL----------------------VTVPPTG
AEPHSR---------------------------KPTQ-----------------------
----L
>gi|126325719|ref|XP_001365700.1|	   1190 residues, 50 /line  PREDICTED: similar to sperm-specific sodium proton exchanger [Monodelphis domestica]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKDSHFPLPLILFFIGCSFEIL-SF-ASYQ--VKQYAEMLQ---WMDPVI-------
--------------FINLFTPIIIFSVSFDIDFYMLQKLFWQIIFLTVPGFFLNYALVDW
YLFS-------VNKLL---LKGITRMLFAIIIVCT--DPMLTTTAIKN-LGL-SKGLTHL
IKGECVFMAALAENTFKITLQI--AN-----NH-HKEISTKLGIIILSDILI---KFVGS
SLFGFVMYKAFQLWLRNIFSDDITEGMLSFSLIYISFYVAE-----WSGMSGIITLTVLA
LLLNS---TSFKPGAQ-LFLFKFWKSLKFFAYLMIFTLIGLMIPAHTYLY----------
------LSFSDIYYAVHFYFTLIVIRILVFLIMSPILSRL--G-YGFTWRWAFTIVWSEM
RGLLNINMALMFSYTD------NALGTEGEKSQI-LLHGVTICLITLMINSITLPRAVIQ
LGLRDITLTQRKS-LYYTVQHFQGIIKASASALRFD---RDLA-NADWNL-VDK------
--KIMFTNPYKLKPEE------------ER------QNLKCPDC---NK--EIRE-----
--------------------------------------------ASINTEI-MELARI-R
LLSAQIASYERQYIHEILSQSAVKVLVGAAGSFGDKKGE-FMSFQTIRAYAEKKK-----
--FFNFVRKILLNWVYNTRKEKG--VPSKNPVLLFCHKIVFNDEFESSVYLIIILNMAPL
LISWIPQLYV---------------------IYEKEARTVNHMFLSFYI-IESILKLAAM
R---------KGYFQHNWNLFELLIIVLGIIEEILMVT----DA----------FKN-SI
YVFQALIVLKISNLLRVFRILKLITPVLLQVIDRR-------------MTHQLSFRYAI-
-------LKGYVQGEADI---ACLI-DKISSSKLVA------------------------
----------------EELRKRV---SMNAERAMKELGY-LEYDHPDIAITMKTKEEINS
LLG---MASEILKNLKSKGIINKAE-----------------VAEIHKIIMAKRKHVFDF
--EPV-------------------------------------------------------
------------------------------------------------------IKLPSL
DEVLYHIS---------------------------WL------NK-SKFHIN-----FIK
KKVKILTFDCGNNIFEEGDS-PRGIFVIHSGMIKRHSSKPYLGLDQQLLETKE-KE-KTV
YADY----------------------------LLSGAIIGELNCL-TE-----KPMTFTA
--TCKTVVETYFINKRDIYDIFNNC----CPS--IEYKMWLKLALAIGAKKVKEILAYED
WTYNLQ---LQLCN-VYVRDVLLGYKVDIYDETVSYVIL---------------------
--VYGSVEDCQLQK---TYFA-PEL--IPKT------------------------CHQIK
GT-ARITKILVIQTSIDLKK---------------CRSNTARYVPVCKHIRAGSKHEEVS
PAFYQETNEDNAKEPFYALIMHVPQRRPSTNSTDDG-YENVVPKH---------------
------------------------------------------------------------
----------------------------------MTKQ---------------LADRCET
EYAVVRVPSSPQPSYSFQDEEYELIMPITH-THYPSHLNWMN-----------------S
GNLNR
>gi|145341792|ref|XP_001415987.1|	   1247 residues, 50 /line  CPA1 family transporter: sodium ion/proton [Ostreococcus lucimarinus CCE9901]
--------------------------MTPR-------------------VGRTLLSAAAS
------------------------------------------------------------
------------------------------------------------------------
--NATAVN-AAAHDDATAPLWFIFISLA-V------------------------------
------------------------------------------------------------
------------------------------------------------------GSAART
A--LHGTSVPYTVVLFIIGMVMAVV-YYYA--D--LGLLEASLSAWGGINPHV-------
--------------LLACFLPALIFESSFSMEWHTLKKVLPKVLILAGPGVLMSMALTGC
VLRV--------FPFD---FSWAFCMMVGSILAAT--DPVAVVAILKE-VGA-SKVLGHL
IEGESLVNDGTAIVVFNVFLAI--AK-----GE-HL-----SFGDVMKDLIT---QPILS
VITGVVVGELCLIWLRNSHKDHLVDITITLFAGYISFMLAEI----VIKCSGVLAVVVLG
WYLSAKGRTFFKGNIQ-HSMHHFWEVLTYAANTIVFILAGFLIVADILLGELDIK-----
------ASD--LGWGILLYLCLNIIRFVVTAMLFPWMNYYK-G-HVLSMRETFIAIWSGL
RGAVGLALALVVLEDD------AHF-TKRERGLT-LVMVSAAVIGTLLINASSAAAMLRI
VGLLTPGLSHDRT-LLAARKAIHERALAHYDEKLDQTGAQYLG-APDFTA-VKQ------
--LVPFLRTQ----TDETE--------IEF-----------KHE---IA-----------
---------------------------------------------KMDAQL-MHEMRD-R
FLAGLCKEVWSMLEDDLIDAKVAHGLLIACERATDKSKS-N-------------------
---------VLCTF------------DEFNRFM---------------------------
---------------------------------------------KQSR-VKSAV-----
------------------------------------------------------------
-------------------------------VKAFERRAWGMRIIKTLRYLRLVEEGWMG
TRRQMQGLHALISAHRLT---SEQF-KSLLGKNEEEEQAKEEAQSEVAELAKSYTLTKAG
VGENLANETSIKSHHVRDVLFES---DTEVVQAVEMLKE-MQHAHNAVARSLRSEALARE
ILE---VTMEETKLLTHTGLLDESE-----------------GSMLQAEHDLYLQRLIMH
--PLP-------------------------------------------------------
------------------------------------------------------PSRTSP
GRILAAIP---------------------------LFDFTQRVGIKSREIRK-----HFL
REAEVVEFNVGDIIIDPNVKLNDGIMLVGNGVVLIESA--------------A-DATQQI
TAGCK--------------------------SHPHAWALALYEAL-ANDANEEEPNRSGI
RATAQTTMF-GFVLPRSLLDSLRGD----LREAETLEFMWRVVLGLLA-ETVLRSELDSV
LPDLPV---NKL-V-RAGKLVKISQGSKLEHDDRQVVIL---------------------
--LRGSLYNNTC---GNIPAP-CVV--TFKRTGMLSNAT---TSASSALESKLESRLSAL
KF-GKNGLVRGSSQNLAAL-AAKMSVDESASESLPVE---PDRDGYCTFESVNDLLIYVI
PTDKLLQSPTSG-----------------------K-SRTSL--RAQKKREFLRGLS--N
KVSRQ--------------RSIFIGPDNRLNAQ----------------KSTMPRRSID-
-------SDRRSIEFDIESGVANATSRSPNRRLSLQLPRQPTVAEDADNPIGEDPRTQLT
SNS----MISLGTDDDNAQDTHRS-DDLVP-LRSRSRVWDDSPIPAPRVLPSRDYEDPST
QHTIS
>gi|145506977|ref|XP_001439449.1|	   1025 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
--------------------------MYIYKA---GIVLLML-------GVGQC------
------------------------------------------------------------
------------------------------------------------------------
-EDQPISA-SSDISGTALSVFFIFFFLG-I------------------------------
------------------------------------------------------------
------------------------------------------------------GSFMKE
I--NKKLKIPFSPMLFVLGLFFGFY-----WDS--LGIIGQSCKKISEIEPIG-------
--------------VLLIFLPTLIYESGYNFDWHLFKRLFAQTAILAFPCVIILSTLLQL
SVKV-------LLNYGDDYFTWESAFMFGAMLSCT--DTVAVLALLKE-SGA-QKRFQSL
IEGESLLNDGACVMLFQISYGI--VR-----GR-SA-----SAFDVGSLFFT---LCVGG
TLIGLIFGMACVYWIKKIANDEILVLNITIVSAFLVYFISENVDF-GVHISGVLGLVSLS
LFMAAFGRSRISHEAD-HALREFWEYVVFASEVIIFILGGIIAGIRVFKDESEI------
-------TQLDFYKMIALWWCLMGCRFISIALFYPWLKNL--G-YGLSWSQILVLTYGGL
RGSIGIAFALIVAKDE--------SLPTKWRDII-LFHMSGIAVCTLVVNGTTLSLLIKL
LGLSTQSDIREKI-YSNFLTKLNEEIDNECKKNNEL---KYLK-EADVEY-VKTLSG--F
KVYQSDCNQI----IDKLAKHEKAQKEIQM------KNIHQPLM---EE--EEEE-----
---------------------------------------------ELDQNL-LTEIRR-I
FLMALKGIYMEQFESNQCSPDTIILLTESANLDLDN-DK-E-------------------
---------HMNSW-EFLQSQFSERYINLLFYM---------------------------
---------------------------------------------KDKF-LIGIL-----
------------------------------------------------------------
-------------------------------ARNH-------------LFSYIYTIYDA-
-------VSAYIEAITIL---KEEA-SHYHFSQNLL------------------------
----------------LEILNEV---EDNKKSAISYLEGYLEVSFPEISRELHTKKAAFE
ILE---FEKSVLKNNLQSGQLNDKE-----------------FLRMKRNIDKKVKNLNDL
--NPP-------------------------------------------------------
------------------------------------------------------WQMPSL
IDILTQHE---------------------------LF------KSLTQPNIL-----KLL
EGSREDSFGRDQLIFKEGDR-ASEICIITRGAGNEFSD--------------R-SKI---
-RERR--------------------------ALN--EATPIYMLVAPS-----IRYQTSL
--VADCVIN-ATFIKIQTLQMIMKQ----IPE--FEEAIWRNSIPLLC-RVYSDQLKPLC
NLKINQ---IVEIV-SKSVFQKIKKNQLIR--FEQGGIL---------------------
--LKGTLCEGK------------------------------------------------E
SI-QEASSEDEDALKNSGE-----------------------------------------
---------------------------------------DQDSTQKDALCLIGPTSSPLR
ARTGIIVLLFKQY-----------------------------------------------
---QMLEQYNQLNQNINEGAKSSNR-----------------------------------
--------------RSSKSDLQKRSLTVVH------------------------------
-----
>gi|145520052|ref|XP_001445887.1|	   1036 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------MSEHLDVAQIAIVIFFIFVALT-I------------------------------
------------------------------------------------------------
------------------------------------------------------GGLVSE
I--TKKIMIPYPAAVFLVGILIGSQ-F----NNIHNHLLHRTVQAAFNIDANS-------
--------------NMTLFLPALVFSSAFNADIYIMKQQIMQIFVLSIPSLLISASLICL
GLKL-------LLEYDDEYYSWGFAFVFGVVVTCT--DTLQVVKLLNN-AEA-PKRFISL
VQGESLVNNCASMVLMLIAVNC--AR-----GD-C-----DLLTVELSYGLS---LLLGG
AFVGIMFGLFTVWWIRRINHNSILTINLTIVSAYVTYFVAESVDL-GFRKNGLIAVITLG
LFMSAFSKIRIRTEVE-HPLQIFWQYTQFANETIIFIITGVTCGYKIFDQQSP-------
-----YIRKQDYINTILLYFYILLSKFISVLLLLPTINLY--G-QQVKMSEAILFSYSGT
RGAVQLMLALLVVKE----PSFS----DQWSDIF-LFHTTFIVILTMLINGSTIPLYVKF
SGLCATAQYRAKV-RLNFLQEMKEQIEFKLNQMKED---YKQK-TIDWNK-VEYFSG--L
AETNTQIQQK----DDKLSKKQL---DEENKHKKEKESSIIGRF-----QKLLKSKGLQD
D----------------------------------------FNDDDIDADD-IIETRD-R
FLMALKQTYWDLYSQNQCGGKAYNLLIESVRWDLDTVEGRMCSWDFIYSVFYSPIYM---
------------------------------------------------------------
---------------------------------RFLYSLNKF------------------
------------------------------------------------------------
-------------------------PIIRGF-------------SGDLLFDWVAIGYEV-
-------ISTYVRAHEEM---ENMI-EEFPINVTLKKK----------------------
------------------LSKES---KENRTNAENFIEGYFYVSFPEIIKLIQTKKSAQG
CLA---SQGKYLLRKYELGELDFQQ-----------------YQKLKLQLNNFVCNVEDI
--RPI-------------------------------------------------------
------------------------------------------------------WPQISI
HTKLKVLP---------------------------LF------SEFNDDLLK-----QLA
LQSKELLFDKDECIYREGDL-ARYFYIITRGRVNETSS--------------A--YINYS
ISKDIGQ---------------------------FLSCHHI--VL-ES-----TLYISQV
--VAASLVE-VIQIEIELMVSLYKQSL----Y--MQDYVWRDSIF----SLSRFYPKELQ
IFSLVDREIIENIL-TFVVFKKYQAYTSVS--FQ-AGILLQGRLTEQKQEKRIRL--EED
QFEMNCND----GLQ---------GPLLFPFLNQ-TYTY-QT----ETACSFF--LFDET
KK----------------E-EIMKLIQ-TERSQER-------------------------
--------------------------------RRTRLQTDLRVSVSGVNRQSFGFSYLL-
------R-----------------------------------------------------
------------------------------------------------------------
---------------------PSKVNL-------------------------------DV
NESKH
>gi|146165774|ref|XP_001015733.2|	   998 residues, 50 /line  Sodium/hydrogen exchanger family protein [Tetrahymena thermophila SB210]
-----------------------MSLEGQI------------------------------
----------------IASG-GH-------------------------------------
---------------------------------------------------------EEA
AGGHHGGGDCMTDHEQPYLILFVIMGLA-L------------------------------
------------------------------------------------------------
------------------------------------------------------GGLLRQ
L--NRKTGLPYTPMLIVVGIIVGCY-R----GS--FGLIGSSAELMSHINPHM-------
--------------ILFIFIPVLIFESGFNCDWYVFKRALVNILILAGPGVLVGAFMLGF
CLKS-------ILGYD-EDLTWNGAFTMGAILCAT--DPVAVVALLKE-LGA-SVRFNTL
IEGESLLNDGTAMVFFLVFFGM--EK-----GE-E-----STPVSVTLNFLR---LAGGG
PALGFICGMVGSFWLRRIIRDDVLTSTVTFITCYFCFYFAEFT---FLGVSGILSIVVLG
LFMSAHGRTKIYPESE-HSVHTVWSFVQYSCETIIFLLTGVIVGKEMVSQ----------
----STIEFMDWVKLPIFWVLMMIARALMVFMFLPCLKYF--G-YGINKAEMWVLIWGGL
RGALGLTLALIVAVDTDLQDEVKFPLGRRLRQLT-IFYMSGVATMTLLVNGTTCGY----
LQMIEVPQIRARV-VKNSKRNLSNACDDKLKELKMN---TFLN-LADWEK-VVEISG--C
SEIKNELVS------------------GAEGQASGRRSTY-----------------SSF
----------------------------------------------DEQEI-CSETRF-R
LLRTLKTYVWEGYEQGQMGPEAAQLLNECINVSLDNTNLPLVVWNNIYSNFTDFATI---
------------------------------------------------------------
---------------------------------RLMFRLKNW------------------
------------------------------------------------------------
-------------------------ILIGTM-------------AKNYITHHMAFVYEV-
-------TTAFITSAEEA---EHLL-HNYPLGQQFINK----------------------
------------------IVNEL---KNQVNDAYKYI-SELQNKFPEIIKAIHTKRAASA
LLE---TQKKFLNEYKNNGYIDDGD-----------------YNDIRKKVDMRCLELENM
--TFN-------------------------------------------------------
--------------------------------------------------WQEVSELQSF
NTFVLRFP---------------------------IF------SSLLPEEIR-----QLE
KCHKSFNFYAGNEIYHEGQK-FDYLYVITQGTVTDALS--------------ASDKSQYT
MIKGMGA---------------------------FLSFANC-VNE-NN-----SRSVSTA
--VAETDCT-LYGIPFATIKGIMSQNK----I--FEKKVYLYSMI----YFIRIFPEKAG
PLRGMEENHLNEYI-VKSEFLALNARQSCN--FEFGGYLLVGQIENTDSGQD-NI--IDE
FSY---------------------------IPPS-SKSY-IT----SKNSYIL--KFTEV
LE----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------RKQSIMDAHFEEQGVK----------------------
--------------KFNQNLVSSSNQY-------------------------------VA
DESQL
>gi|146180705|ref|XP_001021323.2|	   1114 residues, 50 /line  Sodium/hydrogen exchanger family protein [Tetrahymena thermophila SB210]
-------------------------MNNSTDT---SAATYQP------------------
---------------------NY-------------------------------------
---------------------------------------------------------FST
MAAQAID--DSKISTESLVVFFLFGGLM-I------------------------------
------------------------------------------------------------
------------------------------------------------------AGFVRE
I--NKKTSIPYTPMLFVIGIFLGKF-S----ES--MGILGITISKISLINPHG-------
--------------ILIIFLPVLIFESGFNSDWHTFKKQSGQIFLLAFPCVLFSAIFLLI
SIKV-------ILRYDDSYYTWSGAFMFGSILSCT--DTVAVLALLKE-VGA-PKKFNSL
IEGESLLNDGTCMVLFQISSEF--AKKV--DQN-TQNQQYFDLFEVIKLLLS---LTVGG
TLLGIVFGMIAQFWMRRIHNDPILTVNITFIVCYLTYYVAENVDI-GIKVSGIMALVSLG
IYLSIFGKTKISSEEK-RTVYIFWKYVTYAGESIIFILAGVLVGVKVLTSNGDYDTMSGS
DNVSSSIQTSDYFKLFGLYVCMILSRFGSIACFMSWLRKW--G-YGLTWKEVYVLAYGGL
RGAIGNFISISFAMIVANDDSYS----QKLRDII-LFDMAGNAILTLIINGTTTGPLIKS
LGLCVTSTVRERV-FLNILQDLKEDTEKKINYLKSN---NYLK-MVNWDS-VKEYVG--L
ADLEQRITRL----ESDL----T---KREE----------------------IEEYTRNI
----------------------------------------------R-NKN-VIDAKIDE
LKNSNEFQEQQSFDSDSTNHNLDENMIVELNWDLDTEQERMNSWEFLSNYFYNPIYI---
------------------------------------------------------------
---------------------------------KVLFQLKGW------------------
------------------------------------------------------------
-------------------------PIVGSY-------------AGNLLFNHISNIYDV-
-------IAAYIEAHEQA---EQLCIDQFPFIPQVLEI----------------------
------------------IIRES---QDNRMSGEEYIKNDLNVSFPEITKQIQTKKATYS
LLE---CQKKIIKKGILLGKIDEKE-----------------RDILMQQIDDRVVALDNI
--KPS-------------------------------------------------------
------------------------------------------------------WKAPPI
KNFLENVP---------------------------FF------KLIHKDLLP-----YII
KESVEMIFEKDMYIIKEGEK-AKYFFVITRGSATETTS--------------Q-SFCTYQ
EQKEVGS---------------------------LISPHHL--IV-PS-----LRYLTSC
--MANAVVY-VLAFPLSSIQKVIKVNL----E--IKEYVWMQSLR----ALSQLFYNELK
PLGSLDRNSFIKLQ-PKLKFAKYNKGKTIQ--CESGGILLKGQVSRKDLTDV-MM--TQS
KVNNDEVK----KSD-LIDGR-IYKAFCVLMPGQ-AFSV-FT----EKKCTFL--HFAED
CE----------EIRFMIS-HMDYNVG-INQQTPH-------------------------
--------------------------------TLNI-FSPVAVSGSHNKRNSFQAPHLS-
------RFAGRHTFNNLEVVVQGSENKI--------------------------------
---------------NSGQQIELQKMKSKSYLNDQQIK----------------------
--------------SVKSDDEESDD-----------------------------------
-NKEK
>gi|148539552|ref|NP_001091927.1|	   1325 residues, 50 /line  sperm-specific sodium proton exchanger [Strongylocentrotus purpuratus]
---------------------MKKRVVKLREL---VPAV---AALAVAVLIQSATGSSGG
SGHTPTTQATHADDHDLTTHNGT-------------------------------------
---------------------------------------------------------EEH
DDGHDDGH-DDLHAHAPKVIVFISGSCL-F------------------------------
------------------------------------------------------------
------------------------------------------------------GAISRS
L--FKKLPIPYTVVLLILGAILGVV-A----SN--VPLVEEHTRDVAHMDPHV-------
--------------LLQIFLPVLIFESAFAMDVHTFMRSFSQVCILALFGLVVASVLTAV
LAMN-------LFNYN---WNFSEAMMFGAIMSAT--DPVAVVALLKD-LGA-SKQLGTI
IEGESLLNDGCAIVIFNVFMKM--VF-----FP-QLT---STVGQNVLYFLQ---VAVAG
PLWGYAVAKVTVFFLSHIFNDALVEITITLAATYLTYYIGDI----WLEVSGVLAVVVLG
LIVNA-EKTSISPEVE-VFLHRFWEMLAYLANTLIFMMVGVVVTQKAL------------
----VAVDKMDWFYLIILYLAITIIRGMVISLFSPILSRI--G-YGLTWRNAVIMTWGGL
RGAVGLALALVVENLA-----GN----DVIGSKF-LFHTAGIVVLTLVINATTIQTLLRI
LGMSDISIPKRLA-MAGAVRRIHEGQNRTLNMLKSD---RFLA-DADWDI-ATAACE--I
SDPYSALSDD-------E----N---APADELTLGERKSVCPGC-----KAMVPNEPSPR
----------------------------------------------EFADM-MEEARL-R
MLKAEKISYWKQFEHGMLAREALRLLVQHAEVAADEKDQ-FILVDDLKKSWQIKG-----
--IYPWLKRKLEDLISEKKIAAI-PMPKYKLG-KLMYKICHHMAFEVTINIAIVLNIVPI
IMEFVVQDKMASVSTMAAPGSTVSSEPSSLQKIEDALRISNYVFFVIYAI-EAIVKILGL
G---------RHYIVSHWNKFDAFILVVALVDIIIAET-LLKGS----------ITI-NL
SSIKVVKLFRLLRGLRMLRLTKALIPKLILV-------------VNGKINNQLSLGYDV-
-------GKGYIIGEEEV---GKI-IDRMVDNKKILRE----------------------
------------------LKHIS---ETGRLQVVKEL-GLLQREHPGIAVSVKTRQAIRT
ILN---HSRETIHELQGAGLLDEME-----------------AHKLELTVEIKMKRLMNA
--PSS-------------------------------------------------------
------------------------------------------------------IPPPPP
ENLLKNVS---------------------------WL------AG-DMKLID-----FIK
ARASLLHFDYGEVIVREGDE-SDGLFLIVSGLVKLYGK--------------S-AFLDHD
NPPVT---------AGSEENEVFED------YLTVGNVIGEMGVL-TK-----KPRNATV
--TCETTVQ-VYFITAEDMNIAIDTF-TLYPS--LEYRLWRVVAI----RIATPLIMEQM
AFQGWTQEK------------------------------VKLHLERGYLVDLAES--HFQ
FNIDATLE----DVI-LINGT-AYN--AHTREEI-RSPC-LI----SRTVHKLTFQYTAT
EE-PRLFVVRNAEYNGPIL-DGRLDVD-SKRSLIS-------------------------
--------------------------------ITEI-SSNMCLKHAAELRQKNSKVMLS-
------RKSSGAAAKEEEDCIPNTSDVEQAAGV----------------SPSVPTKT---
-------TPKPKSFLPSLGLSMSKERVNGEAVEESPVK----------------------
--------------TKQGEETPETEEG-------------------------------AA
PRVNV
>gi|71412494|ref|XP_808429.1|	   1208 residues, 50 /line  Na/H antiporter-like protein [Trypanosoma cruzi strain CL Brener]
--------------------------------------------------------MDEP
A-----------------------------------------------------------
------------------------------------------------------------
--KGNDAA-EELETL-SQNVLFLMMLIFCG------------------------------
------------------------------------------------------------
------------------------------------------------------GTFFMT
--NMSKIPLPYTVVLFLYGIFVGFF-A----HW--I--TPDVATSLGNIPPEL-------
--------------LFYIFLPVLIFEGSYAMNVHALRRVFPQVLILASVGVVVNTCLLAL
PVAC-------FFP-E---WSWYSALLLGSLLSAT--DPVAVVSLLKG-LGV-DSRITAM
VDGEAIMNDGTAIIAFKLLLPA--AR-----VG-CLK---DSTWNIILKGVQ---LAALP
IIVGPVFGFIQSYWLRHA-TGGIVKTCITVSVTYVCYYVAGN----IIGTSGVLTLFFSG
TFLSFYCPSLFPGREG-NLVYNIWEFLVHLGNTMLFSLVGLILVADVV------------
----PTLNILDLIIIICMYVAVIMARFLMLEILLPILNLF--P-YRMSQREVTLLAHAGL
RGGVAVTLALAVLQTG----I-------EAGVNI-LKVTCGVVLLSLFINATTAEKVVTF
LGHKRKQEHRMIQ-MEYAMDHLEVVRQKALQKNKNN---VSYR-SANWAA-AEAYVKEHL
LNPYK----G----MSYL----R---ED--------------------------------
--------------------------------------------------E-DTVVNR-L
LMKAFKASLWRQRDENLISETVVLTISRAVARAIDS-GE-LIEVRHLHRRKPSPHVEMTE
ELEARLIEENLKP-LWVTVSE-------IFLG-KGYLEWAHVRVQ---------------
-------------------------------------------QNAFMTL-LSFARCLDE
VNPIKYQY----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------AKNELHGRRIEAWM---TSQREEVRRVI-RLLYETYPAATMCIATSRAVLR
AVN---ELRKGVEELHHYHGFGAKP-----------------TAALEEMVQHMYEHIPRS
WEPPRLDNELVIAALAATPLGRGLDPEEINTLSAMGSTKNLYEGEEIKLEDKLFHVIVFG
SLKPKLNRWTASSEGEYGFGCVIGLERFVVPPQLRDNQMNRWVVTSTECQVLCIAYRYIE
PFLWEKSFASVRAFWRAVAVETLLPTLEHMITLPVNL------TQ-SSRDHF-----TSI
MMSGNPLIGPKECNAMDWSL-QFQLCFYIRG------S--------------D-TTGLFC
NGHTAPCYVSAFFARRLKWEDPQVVLYAVPVNVSDSGYVPWSQSA-NK-----SPRGSFM
--PQRSSAA-EA-----------------------------DLSS----AMMLDYIHHEP
SSTYAEAAD------------------------------IFSSILRGIIPGE-NQ--PRS
FKIDPPVA----DVG-SFDGVDACI--LQNPENF-VTN--------VPYLNQLFLRYATV
LEGLCIAALRYVRVPTDPL-NAKHAQY-ISEQALE-------------------------
--------------------------------FLMVFFNELTILSAALRRLSRRDTTTS-
------SFAHGVKRQEKEEQLQDDELEDIRMIGKVIMWHRVAEMHGA-----FQLRT---
-------MVLQMKSLANRRFRYLSESLRALAEEQPSLK----------------------
-----------------GADSVEELQR-------------------------------IL
LDLNP
>gi|91086579|ref|XP_973405.1|	   1115 residues, 50 /line  PREDICTED: similar to sperm-specific sodium proton exchanger [Tribolium castaneum]
---------------------------MFRKL---SIIIFLL-------YLAQILAEDTP
K-----------------------------------------------------------
------------------------------------------------------------
---------KRPPPDFSVKYIFIFGCLLL-------------------------------
------------------------------------------------------------
------------------------------------------------------VTKTRH
FIINKGIPVPYAAVCMTCGVLWGVG-T----WY--SPWMEDVSLVWPTIINEF-------
--------------D-VIFLPAMVFSTAICMDIHTFLYSFPQIFVISFPVALLASAMFGI
LMRL-------VIDRK---WTVVDSLYFGALTQAI--YPTEMLRLLKE-SGHRTKCVAIL
LEGETLLSVSIAVAFTQMLGLH--IG-----GW-IV-----HWYQWLMGLVR---TVVVA
LPLGYLFGVFGTFLMKLSYTDTSGLLIVTISMCYMSYYIVQ-----WISSAGLPACTICG
IFMG-RARATLSKERE-ESIINFWKMVIIMMCGILFVVAGVIAPITLR------------
----INVQMKEYVLVLVTYLMANVTRFLSFFLFSPILSRT--G-YGMSFQNMLICVWGGL
KNPLILNLAVDLTMKV----YGE----NSHRRQILYLHVVGLYMLMLFINATFIPVLLRS
LGLMELSLSRRIN-MNNCLKFINEARTRTMAILKMD---RFLS-DANWPL-VTKCTT--M
EHPYRKKAST----EAEQ----E---EQEDEYLLAYKFTFCPDC-----QKEVPNEPTPK
----------------------------------------------EMKDM-MKEAKL-R
ILKLKKTAYSRQYENGMISRHAIRTMHQTVEIAMDSQEA-VIELDGLYKLF---------
------LRNHLQK-FLRNKSDTV-KPPRLEWR-LWCYRIVTHVAFTIFMNLVVLFQMVFI
LYYFAVRVEKDDV-----------------------------------------------
------MHGFRTYFRSCCNVLEFIILLGVFMIIVFHATLNLTGAHMCYYVDLAL------
CFLLILRSLKLLRLVNYLAFCQRLPVALSKY-------------LDAKVDKHRALAFEL-
-------GKCYITGEEEI---LEN-LHQIVDNDKIRES-----------------IRERI
ENDRLAITKRLGLAQKESIRERI---ENDRLAITKRL-GLAQKESPWVTTTVKTRLAMRT
VLN---GMKDDIYELKLSGWVDDLE-----------------YDKLLKSLSKRYKYV---
------------------------------------------------------------
-------------------------------------------------DSVKLIPPPTS
KAVFKEIP---------------------------YM------AE-EPELIE-----FLY
TNVSTKKFDPGEVVIKEGEN-LEGIYILISGMLMASYT--------------P-HPLILD
NLKEKGAIPVVDHICSLTYDEPMSE------YIVPGNSIGELSTL-TG-----RGYDGKI
--LSETHSQ-VYVLYKPFIKKAMEMDDDPVNG--FECRIWKYISF----RRALTVMMNVP
SFRSVTQQN------------------------------LKYTLERSFLPNL-SN--YKV
FVVNEMME----DII-LIEGL-VVD--FNTRDVY-AAPC-YI----PR------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----
>gi|91086619|ref|XP_974158.1|	   1271 residues, 50 /line  PREDICTED: similar to sperm-specific sodium proton exchanger [Tribolium castaneum]
----------------------------MPKI---NLLLILALCESCNAFLNRTVGSDNP
R-----------------------------------------------------------
------------------------------------------------------------
-----AIY-PSIPAEH--NVFYFFVIVML-------------------------------
------------------------------------------------------------
------------------------------------------------------ATIIRI
VLIRYDIPTPYGAFMIMVGVIWGII-C----NH--NLFVLLASDAM-NTNPVD-------
--------------LVCVYLPALVFSTSFSLDVPIFLKTIPQLLVIGIFVTFLTGTLFGV
LMRL-------VIEPS---WSIKVGLTFGIFIVPI--NPASIVYLLKQQTT-ATRHISAL
LEGEAIFNMLLAEMTHDLIINF--AK-----GF-VV-----HWYQFVMVLIR---FILFG
IAFGYFVGLLGRYMMRTLYRYPLTIFMISFGFPFFTFFLSDI----YISGCGSISVMILG
TMMA-MERSVLAKETN-QFLTDMWETIGYSLDAVMCVTITLLATVEVA------------
----TIVTTSAYIRIIVTYLTYYSIRFICFLLFAPIISRL--G-YGMDLKCMIVCVWSGL
KSPFSLALSLIFVEDA----I-S----AEKMKRI-FFQCVGIYFLSVLINGTFTRKILEF
LGLREISMARKIN-MTNCMKHIFTKRNKTVAILKMD---RFLA-DVNWPV-VLEATD--M
KHPYRMGMED----TEE-----------DNFFLLGYRFTVCPDC-----KSEIPKEPTTR
----------------------------------------------ELKDM-AKEAKM-R
VLKSKKMCYARQYENGMMTKEGIKILSQAVELAMDTEAA-VIQLEGLEKRFKEEN-----
-CIYRCIRKKVKH-LNRSQADSI-RPPRKYFR-RLCYRICINNTFEHFMLVIITIHCVFI
TVSTIYHPPIDHL-------------DTIDKKLDVAISVLDLIFSIIYIV-EVILKIMAF
SWIHFWEHGVKTYFKSVWRNIDFLVVVTCILQGYYDL--------KCFYAQIPESKY--G
VFYRVLTCLRLLRVVRLFTVLKIFYPKFVTY-------------LDRSVDSQLAFTYEL-
-------GKSYAIGETEI---LDM-LPYMIDNTAIREE----------------------
------------------IKQKI---ERDKVIITKLL-GMVQKEKPWIAITVKTKQAIRT
ILN---SMKEAANQLRTAGWVDDYE-----------------QEKLFQVMGELWSKV---
------------------------------------------------------------
-------------------------------------------------NSIKSVQPSAP
KVIFKEVA---------------------------WM------AG-DQAVID-----FLF
ENVTVKKFEPGDVVFEEGTV-ADGIYIVVTGLFMIIYK--------------P-ESNVLT
SLHEYGQLPIADYLSATQYEERVVD------YIVSGNCIGELSTL-TG-----RAYNCTV
--SADAHCQ-VYVLSKGVIKRAMELNPDPVIG--LECRLWKEVSI----RMAVPLLMSVP
AYQGFSQDQ------------------------------IKYALERAFVPNL-SN--YKI
FAVTDMIE----DII-LIEGC-AAD--FNTRESF-VAPC-CI----PRTVQKLILPKSSL
INIPVLLETKLLIIPEKDV-DEYDVMI-LAEDMCE-------------------------
--------------------------------LVDTGASMKCLQHATQE-----------
-----------------------------KTRKKKVKMMAARKKGTAVSKTLSKLQP---
-------DSND--SVGMLFFKRTDSETNSINMEEEEEN----------------------
-----------------KRNAEQTKQS-------------------------------KT
N---P
>gi|145517548|ref|XP_001444657.1|	   986 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
--------------------------MAEHE---SEFEGHEEELE---------------
------------------------------------------------------------
----------------------------------------------------------AP
KDSLWR--DEHEMEKSANIVYFLTLGIV-S------------------------------
------------------------------------------------------------
------------------------------------------------------GLILRE
I--NKKTKLPYSPMILSLGILLGLL-Q----KS--LGYVGESASILSKMHPHL-------
--------------IVFVFVPVLLFESAFNCDWYTFKYQMVNILLLAGPGCGWGAILLGA
IFKL-------VLQYDDNDMTWYQAFTLGSVLSAT--DPVAVVALLKE-LGA-SLAFNHL
IEGEALLNDGVAMVFFIFFNKF--SKAASGKGE-A-----VTASQVVLNFVR---NSLVG
PALGLILGILAALWTKRILGDDIEVTWLTFVFTYLTFYWAEFC---FFKTSGLLAVVGLG
LFWSAFGKTRIRSSVE-HSVHTVWGFVQYSCDTLIFLLVGIIVGTQVIEET---------
-----FIHKSDYIRMIVFYFFMILARFIMILTFWPFLRCF--G-YPISKSEFIVLVYGGL
RGALGLTLSLMVGCDEE--------LPARFRHLS-VFYGAGMAAITNLINGTTCKALVQY
LEMIENPVVKKKV-YKKYLEELIVNSQDKMRELESD---QFYS-MADWNQ-IEKLET--E
IKYMLGSNKV----QTS-------------------------------SSNLYEG-----
---------------------------------------------LTDQEI-FGEVRY-R
IYRILKGLYYDKFEYGLCEEDTVRLLVESSDIGLDHTKAILNIWDQLYKNF---------
---------------------LN--FSSV-------------------------------
---------------------------------NFFFKVKEM------------------
------------------------------------------------------------
-------------------------PLIGPFARDY-------------MIKHLGFVYDV-
-------TTTFLSCASEA---FHLT-GTFPMSKDAI------------------------
----------------RVVMEEL---NKEIEKAEGYLG-ILNDTFPEIVRAIQTKRASHS
ILT---HQRHYLDDTQQNGLVDEKE-----------------YQLLKKEINTRLVDLENH
--QFD-------------------------------------------------------
------------------------------------------------------MVLPSF
HVLAMEFP---------------------------IF------SGLVSTDLD-----NII
KSAYEKKFGPDEIIYEQGMT-CQNIYIVSKGNVVDEFA--------------G-GTIRKG
LGTL----------------------------ITYTNLIGDGTCM------------STA
--KTTADSL-LYSLNLKILKDLMSKNP----D--FEFKIYINSLEYLR----KMFENQAG
PLANVEIKRLLDFLRTKSKLKKFTTNQKCD--FIFGGYLFRGELKDIN----NQV--YSQ
YTY-----------------------IPPQ-----DTEC-----LVTKDCQCL--TFEDS
VD----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----SFNNQMLKQLDLDPHKDQQIQERYSQ-IKRTSMMEKSKL-----------------
----N
>gi|145543418|ref|XP_001457395.1|	   994 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
---------------------------MGQE---GEAITSTEGT----------------
------------------------------------------------------------
----------------------------------------------------------QI
QDSLYR--DEEKMEESANVAYLLTLGIL-L------------------------------
------------------------------------------------------------
------------------------------------------------------GLALRE
F--NKKTKFPYSPMVLACGLLIGLL-Q----ST--LGYLGESASILSHMHPHL-------
--------------IVYIFIPVLLFESAFNCDWYVFKYQMVNILLLAGPG---GAILLGI
VFKV-------FLFYSNEDMNWYQAFTLGSVLSAT--DPVAVVALLKE-LGA-SAAFNHL
IEGEALLNDGVAMVFFIFFNKL--SKAAAGIGG-G-----VTFGGVLLNFVR---NSIVG
PVLGVVVGFFGALWARRIVGDDVEVGWLTFIFTYLTFYWAEFC---FFKTSGLLAVVSLG
LFWSAFGKTKIRSESE-HAVHTVWSFVQYFCDTTVFLLVGMIVGTEVIEER---------
-----YIYTSDYFRMIVFYFFMIICRYLMVISFWPLLKKY--G-YPMSQPELIVFVYGGL
RGALGLTLSLMVGCDED--------LPPRFRHLA-VFFTAGMAALTNLVNGTTCKALVNY
LNMIENPVIKKKV-YKRYLTDMIVDQEDTIKELEGD---DHFA-MADWNQ-VKSLVG--S
QQFLQEVVQL----ENE-------IKQ---------------IQGGNLSRVSYEG-----
---------------------------------------------MTDTDT-FGEVRY-R
VLRILKGLYYSKFEHGQCDEDSVRLLVESSDVALDHTGSILNIWEQLFQSF---------
---------------------TS--FSSI-------------------------------
---------------------------------KYFFRAKEW------------------
------------------------------------------------------------
-------------------------TFLGGYAQQY-------------ITKHLGFVYDV-
-------TTTFISCANEV---LTLQ-EHMPMNKSAV------------------------
----------------RLIMEEI---KTEINKAELYLA-TLNDTFPEVIRAIQTKRASHT
VLM---HQRHHLEENQKNGLVDDKE-----------------FNQLKSNIDARLVQLENH
--VFD-------------------------------------------------------
------------------------------------------------------WQIPTF
HSFAMEFP---------------------------VF------AGVPKEELD-----TII
KSTYEKRYQSDEIIYEKGMT-CQNIYIIQKGNVIDEVG--------------S-HQLKKG
LGSL----------------------------LSYANLIGDGKCM------------TTA
--KAASETV-LHSLNLNVLKSLMQKSE----A--FEQKIYVNSIEYLI----KLYESQAG
PLGQMEQKRLGTFLRQKAQFRKFDVHSNVE--FMFGGYIIKGEIQSCIQDENEGVERYND
YCY-----------------------VPPR-----ENDF-----NVTKALICL--VFDDA
ID----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MIKQDRLEQFNLENH-EEIIDQRFSR-IDVQQQYQQQE------------------
----L
>gi|145546003|ref|XP_001458685.1|	   994 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
----------------------------MEA---EDTHSEGENV----------------
------------------------------------------------------------
----------------------------------------------------------MH
QDSLFR--DEEKMEESANVAYLLTLGIL-L------------------------------
------------------------------------------------------------
------------------------------------------------------GLALRE
V--NKKTKFPYSPMVLSCGLLIGLL-Q----SS--LGYLGESASILSHMHPHL-------
--------------IVYVFIPVLLFESAFNCDWYVFKYQMVNILLLAGPGVGWGAILLGI
VFKL-------FLFYSDEDMNWYQAFTLGSVLSAT--DPVAVVALLKE-LGA-SAAFNHL
IEGEALLNDGVAMVFFIFFNKL--SKAAAGIGG-G-----VTFGGVILNFCR---NSIVG
PVLGVVVGFFGALWARRIVGDDVEVGWLTFVFTYLTFYWAEFC---FFKTSGLLAVVSLG
LFWSAFGKTRIRSESE-HAVHTVWSFVQYACDTTVFLLVGMIVGTEVIEER---------
-----YIYTSDYFRMIVFYFFMIICRYLMVISFWPLLKKY--G-YPMSQPELIVFVYGGL
RGALGLTLSLMVGCDPD--------LPPRFRHLS-VFFTAGMAALTNLVNGTTCKALVNY
LNMIENPVIKKKV-YKRYLTDMIVNQEDTIKELEGD---EHYA-MADWNQ-VKALVG--S
QEYLQEVVQL----ENE-------IKQ---------------IQGGNISRISFEG-----
---------------------------------------------LTDSET-FGEVRY-R
VLRILKGLYYSKFEHGQCDEDSVRLLVESSDVALDHTGSILNIWEQLFQSF---------
---------------------TS--FSSI-------------------------------
---------------------------------KYFFKAKEW------------------
------------------------------------------------------------
-------------------------TFLGGYAQQY-------------ITKHLGFVYDV-
-------TTTFISCASEV---ITLQ-QHMPMNKGAV------------------------
----------------KLIMDEL---RNDITKAEIYLG-SLNDTFPEVIRAIQTKRASHT
VLM---HQRHHLEENQKNGLVDDKE-----------------FNSLKANIDARLVELENH
--SFD-------------------------------------------------------
------------------------------------------------------WQIPTF
HAFAMEFP---------------------------IF------TGVPKEELD-----TIV
KSTYEKRYQQDEIVYEKGMT-CQNIYIVQKGTVDDEVG--------------T-HILKKG
LGSL----------------------------LSYANLIGDGKCM------------TTA
--RAASETV-LHSLNLNVLKSLMSKSE----V--FEQKIYINSIEYLI----KLFESQAG
PLAQMEAKRLGQFLRQKTQFKKFDVHSNVE--FMFGGYIIKGEIQSCISDDGEGIERYRD
YCY-----------------------VPPR-----ESDF-----TVNKPLICL--VFDDA
ID----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----IIKQDRLEQFNLENH-EEIVEERFSR-IEVQHQQQE--------------------
----F
>gi|145543420|ref|XP_001457396.1|	   997 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
----------------------------MSS---DDLGGQDENYES--------------
------------------------------------------------------------
----------------------------------------------------------IQ
RDSLWR--DEHQMEESAQLIHFLVLGLI-C------------------------------
------------------------------------------------------------
------------------------------------------------------GLILRE
F--NKKTNIPYSPMILALGLAVGLS-Q----EY--LGKIGNSAHILSKMHPHL-------
--------------IVFIFIPVLLFESAFNCDWYTFKYQIINILLLAGPGCGWGAILLGA
CFKL-------VLQYGDEDMNWYEAFTLGSVLSAT--DPVAVVALLKE-LGA-NPAFNHL
IEGEALLNDGVAMVLFNVFNNI--SKASSGKGE-A-----VNGGDIILTFLR---TSFLG
PIMGLILGLLVALWTRRILGDDVEVTWLTFVFTYFTFYWAEFE---FFKTSGLLAVVGLG
LFWCAHAKTRIRASVE-HSVHAVWGFVQYSCDTLVFLLVGIIVGIEIMEEK---------
-----LILTSDYYKMVGFYFLMILARLLMVLTFYPFLKCF--G-YPISKSELIVLVYGGL
RGGLGLTLSLMVGCDED--------LPARFRHLA-VFYAAAMALITNMINGTTCKTLVKC
VKMIDEPIVKKKV-YKKYLEELIVIQQDLVKELETD---EFYN-MTDWAT-VNNLIG--Q
QDFIEKIDKV----EQE-------IKH--------------LIQKRGFQEMIYEG-----
---------------------------------------------LPNQEV-FGEVRY-R
FYRILKGLYYHKYEEGLCEEQTVRMLVESSDVGLDKLSDNLEIWDELYKNF---------
---------------------MN--LCSV-------------------------------
---------------------------------NFFFKVKQK------------------
------------------------------------------------------------
-------------------------FLIGYFAREY-------------LIRHLGLVYDV-
-------TSSFIICAEEA---LKLA-DNFPMNKEAI------------------------
----------------SIIQEEL---KKEIEKAQSYFG-TLNGSFPEIVRVLQTKKASFS
ILT---HSIEHVQSTQRRGLIDDKE-----------------YKILMKDINIKLVKLESH
--SYD-------------------------------------------------------
------------------------------------------------------MSLPSF
HVIAMQFP---------------------------IF------QEISLSDLD-----IIK
KVAVERKYALGQVIYSKGSE-CNEVYIIMRGYVVNEYN--------------G-ILITKG
LGSL----------------------------ITHQSLIVDGNHM------------STA
--KAAVESL-LYALPTKVIKEVMIRNK----D--FEFKVYLHSIEYIR----KWYENQVG
PLAQMELKRLNELLRNKSRLVKLTTLSQIE--FINGGFLFSGELRDPK----NNV--FNK
YDY-----------------------IAPT-----EGLF-----TAAANSTCF--VFDEQ
IE----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----VLQSKRMKELKLDSQRDQEIHEKYSE-IKRNSVLELSKI-----------------
--NIT

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.