Fandom

Proteins Wiki

At2g01940.2/PDB

< At2g01940.2

47,923pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/2-01940-1-2gliA-2.pir.txt

======================================================

Assigned types to 445 residues in Sequence 2-01940-1, 17 remain unknown
Assigned types to 130 residues in Sequence 2gliA, 332 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 144  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 145  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 146  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 161  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 162  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 163  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 164  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 165  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 179  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 191  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 192  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 193  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 222  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 223  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 239  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 253  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 254  All residues are positively and negatively charged

Translated sequence file 2-01940-1-2gliA-2.pir.txt into sequence alignment.

======================================================

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

>2GLI.pdb  Made from 2125 ATOM records in 2GLI.pdb
ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFK
AQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMC
EHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHV
KTVHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

======================================================

Best alignment:
2GLI.pdb     77  KSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNE   126
                 K   R  N++   R +   +P    H  C  A  +     KH  R HSN 
2-01940-1   100  KLLKRDNNIEVKKRVYVCPEPTCLHHNPC-HALGDLVGIKKHFRRKHSNH   148

2GLI.pdb    127  KPYVCKLPGCTKRYTDPSSLRKHVKT   152
                 K +VC+   C+K Y   S  + H+KT
2-01940-1   149  KQWVCE--RCSKGYAVQSDYKAHLKT   172

======================================================

Highlighted IDENTICAL residue LYS  179  index1   77  path  100  %Seq  50.00
Highlighted IDENTICAL residue SER  180  index1   78  path  101  %Seq  50.00
Highlighted IDENTICAL residue TYR  181  index1   79  path  102  %Seq  50.00
Highlighted IDENTICAL residue SER  182  index1   80  path  103  %Seq  50.00
Highlighted IDENTICAL residue ARG  183  index1   81  path  104  %Seq  50.00
Highlighted IDENTICAL residue LEU  184  index1   82  path  105  %Seq  50.00
Highlighted IDENTICAL residue GLU  185  index1   83  path  106  %Seq  50.00
Highlighted IDENTICAL residue ASN  186  index1   84  path  107  %Seq  50.00
Highlighted IDENTICAL residue LEU  187  index1   85  path  108  %Seq  50.00
Highlighted IDENTICAL residue LYS  188  index1   86  path  109  %Seq  50.00
Highlighted IDENTICAL residue THR  189  index1   87  path  110  %Seq  50.00
Highlighted IDENTICAL residue HIS  190  index1   88  path  111  %Seq  50.00
Highlighted IDENTICAL residue LEU  191  index1   89  path  112  %Seq  50.00
Highlighted IDENTICAL residue ARG  192  index1   90  path  113  %Seq  50.00
Highlighted IDENTICAL residue SER  193  index1   91  path  114  %Seq  50.00
Highlighted IDENTICAL residue HIS  194  index1   92  path  115  %Seq  50.00
Highlighted IDENTICAL residue THR  195  index1   93  path  116  %Seq  50.00
Highlighted IDENTICAL residue GLY  196  index1   94  path  117  %Seq  50.00
Highlighted IDENTICAL residue GLU  197  index1   95  path  118  %Seq  50.00
Highlighted IDENTICAL residue LYS  198  index1   96  path  119  %Seq  50.00
Highlighted IDENTICAL residue PRO  199  index1   97  path  120  %Seq  50.00
Highlighted IDENTICAL residue TYR  200  index1   98  path  121  %Seq  50.00
Highlighted IDENTICAL residue MET  201  index1   99  path  122  %Seq  50.00
Highlighted IDENTICAL residue CYS  202  index1  100  path  123  %Seq  50.00
Highlighted IDENTICAL residue GLU  203  index1  101  path  124  %Seq  50.00
Highlighted IDENTICAL residue HIS  204  index1  102  path  125  %Seq  50.00
Highlighted IDENTICAL residue GLU  205  index1  103  path  126  %Seq  50.00
Highlighted IDENTICAL residue CYS  207  index1  105  path  128  %Seq 100.00
Highlighted IDENTICAL residue ASN  213  index1  111  path  133  %Seq 100.00
Highlighted IDENTICAL residue HIS  220  index1  118  path  140  %Seq 100.00
Highlighted IDENTICAL residue HIS  225  index1  123  path  148  %Seq 100.00
Highlighted IDENTICAL residue LYS  229  index1  127  path  152  %Seq 100.00
Highlighted IDENTICAL residue VAL  232  index1  130  path  155  %Seq 100.00
Highlighted IDENTICAL residue CYS  233  index1  131  path  156  %Seq 100.00
Highlighted IDENTICAL residue PRO  245  index1  143  path  171  %Seq 100.00
Highlighted IDENTICAL residue HIS  251  index1  149  path  177  %Seq 100.00
Highlighted 36 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/2-01940-1-2gliA-2.pir.txt.2GLI.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues 2-01940-1-2gliA-2.pir.txt PIR amino_acid 2GLI.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.