FANDOM


>gi|145328244|ref|NP_001077868.1|	   446 residues, 50 /line  SGR5 (SHOOT GRAVITROPISM 5) [Arabidopsis thaliana]
-----MRTDQV-----MLSNKNTNT------------------------CCV--------
---VSSSSSDPFLSSSENGVTTTNTSTQ--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KRKR-RPAGTPDPDAEVVSLSPRTLLESDRYICEICNQ
G-----------------------------------------------------------
-------------------------FQRDQNLQMHRRRH-KVPWKLLKR-----------
-DNNI--EVK-KRVYVCPEPTC---LHHNPCHALGDLVGIKKHFRRKHSNHKQWVCERCS
--KGYAVQSDYKAHLKT-------------------------------------------
------------------------------------------CGTR-GHSCD-CGFFSSF
R--------------VESFIEHQDNCSARR--VHREPP----------------------
------RPPQTAVTVPACS--SRTASTVSTPS----SETNYGGTV--AVTTPQPLEGRP-
--------------I---------------------------------------------
-------------HQRISSSILTNSSNNL-------------------------------
NLELQLL--P-LSSNQNP--------------NQENQQQKVKEPSHH-------HNH---
----NHDTTNLN----LSIAPSSSYQHYNNFDRI---KEI---MA----SE---QIMKIA
MKEK-AYAEEAKR------------EAKRQREIAE-NEFANAK-----------------
------KIRQKAQAELE---RAKFLKE-------------------QSMK-KISSTIMQV
TCQTCKGQFQAVAV--PAATADETSLVVSYMSSANTDGELE-------------------
-------------------------------------NG-------------F
>gi|109458333|ref|XP_218433.4|	   441 residues, 50 /line  PREDICTED: similar to zinc finger protein 112 [Rattus norvegicus]
-----MTRSFGW----WR------QTPKRVGSQ-----DFP-------------------
------------------------------------------------------------
------------------------------------------------------------
-------------AVRPQGQPHNRTCCTSFGQTLCLQ----GHQKLHIREKP--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------YKCS----ACGKGFSHRRALQVHQRIHTGEKPFKCGECGK
GFSRSAYLQAHQRVHTGEKPYKCGECGKGFSRSAYLQGHQRVHTGEKPYKCEECGKGFSR
SSHLQGHQRVHTGEKPYKCEECGKGFSWSFNLQIHQRVHTGEKPYKCGEC-GKGFSKAST
L----------LAHER-IHTGEKPYQCHECGKNFSQKSYLQSHQSVHS-GERPYICEVCG
--KGFSQRAYLQGHQRVHTLVKPYNCEVCGKGFSQGSRLEAHRRVHAGGKPYKCETCAKG
FSESAGLQAHQRIHAEGRAYKCELCGKGFSGYSGLQAHQRVHTGEK-PYKCEVCGKDFS-
Q--------------RSNLQAHQRVHTGEKPYTCD-------------------------
--------------ACGKGFR---------------------------------------
------------------------------------------------------------
------------------WSSGLLVHQRA-------------------------------
HSN-----------DK--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------FCRNGE---F---------------------------------------
------------------------------RSSYLPENLGRN-EG---------------
----------------------------------------------------L
>gi|125528447|gb|EAY76561.1|	   366 residues, 50 /line  hypothetical protein OsI_004408 [Oryza sativa (indica cultivar-group)]
-----MEGEVV------------------------------AASPFFEWLKP--------
---P--------------------------------------------------------
------------------PRPAS----SSSWSSSFSSSSSMASRDQETVVPG--------
---------------------------------------------EDGGGEI-------Q
EDHKSGMTCLPLLSMLEE-------------GNSKRHE-HP-VKEEIMSSAHAAGVVEPG
VE-------------------------------LNIGLPVTGSSA-------QE------
VTMEEDDEEEDDDDVG--------------------EEEMDEWKPMHGGCKVEGDEEQYG
EAVASVEGSSSITAVGDMFGGVGA----ESGVAMSSRYWIPTPAQILVGPVQFICHVCNK
T-----------------------------------------------------------
-------------------------FNRYNNMQMHMWGH-GREYRKGPES-LKGTQTLAM
L----------KLPCYCCAAGCKNNVAHPRARPLKDFRTLQTHYKRKH-GAKPFRCRRCA
--KPFAVKGDWRTHEKN-------------------------------------------
------------------------------------------CGKR--WFCA-CGSDFK-
H--------------KRSLNDHVRSFGAHHLPVAE-------------------------
--------------SA--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------A--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------AAATTP---A---------------------------------------
-------------------------------------DKDRI-ISF--------------
------------------------------------QR---------------
>gi|42407670|dbj|BAD08819.1|	   438 residues, 50 /line  putative transparent testa [Oryza sativa (japonica cultivar-group)]
-----MEDPYTS----FFKNPYYYYCTSASSFP-----TAPAAAAAAAHLPP--------
---P--------------------------------------------------------
------------------LPPPY----AALYPTAGGVGVGVGAHHHHQYPPAAFFHPPPV
HQQHQAPPSPPLREALPLLSLSPTPARRGGVVDAAAD----SDSDDDDDGDCCYHHLQDQ
EGAAAGSTATPAAAAARAPLFADLNCIPTCCGDDNDGG-DP-MDVEV---AGTTADIDAA
VA-------------------------------LRIGLPAGGTEA-------DL------
LS------------GL--------------------TGAGVEHEEEEEDCKVDGGGSGGD
DEVVPL-------------GFSST----PIGKLNKGQYWIPTPSQILIGPTQFSCPVCFK
T-----------------------------------------------------------
-------------------------FNRYNNMQMHMWGH-GSQYRKGPES-LRGVQPTAM
L----------RLPCYCCAAGCRNNIDHPRARPLKDFRTLQTHYKRKH-GLKPFLCRKCG
--KAFAVKGDWRTHEKN-------------------------------------------
------------------------------------------CGKL--WYCL-CGSEFK-
H--------------KRSLKDHARAFGHAHTALDA-------------------------
--------------DD--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------D--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------DGAVSD---A---------------------------------------
------------------------------DAVVRPSSSMAA-SSL--------------
------------------------------------QP------------PPR
>gi|125562577|gb|EAZ08025.1|	   441 residues, 50 /line  hypothetical protein OsI_029257 [Oryza sativa (indica cultivar-group)]
-----MASA---------------------------------ERRIRMWWRT--------
---A--------------------------------------------------------
------------------GRPKH----LWGRRSMLYMGHSRIYMDRYYDPIELHGQPPPL
LMIPGG----GGGGGGGGGGISPYLVQSQHGHGGGVD----GMEMEEGGGFM-------G
EQPQ----CHPLLYNLSV-------------LKDRVQQLHPLVGLAVAHNAHAHGPLDVS
AAD----------AIIQEIVAAASSMMYAFQLLCDLGTAPTTAPS-------QETAAASA
VVVKNNDHAADAGQME--------------------DDHLMQQQWQQNGSRQH-------
------DYSSHAHAPPVFHSETAA----PAGATSATDTIIELDAAELLAKYTHYCQVCGK
G-----------------------------------------------------------
-------------------------FKRDANLRMHMRAH-GDEYKS-KAA-LSNPTKLLA
KGGDETMAAA-ARKYSCPQEGCRWNRRHAKFQPLKSVICAKNHYKRSH-CPKMYVCNRCG
-RKHFSVLSDLRTHEKH-------------------------------------------
------------------------------------------CGDH-RWLCS-CGTSFS-
R--------------KDKLIGHVSLFAGHQPVMPL-------------------------
-------------DAPRAGKR---------------------------------------
------------------------------------------------------------
------------------QRS---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------SS---A---------------------------------------
------------------------------SVAGNIDDTTGI-GMG--------------
------------------------------------A---------------A
>gi|125582592|gb|EAZ23523.1|	   384 residues, 50 /line  hypothetical protein OsJ_007006 [Oryza sativa (japonica cultivar-group)]
-----MKST------------THLLAGGGGGGS-----VAPPTAATAPTLAM--------
---E--------------------------------------------------------
------------------VGDPS----GALVGGAGGAGAR--------------------
-----------------------------------------------------------G
GDGD----ARDALLRLVA-------------LGDRMAAVRRRIAASISGES---GPLSSS
DIH----------SVSSEISSAAHLVVLNAASLLSSTVASLPAPP-------PPPA----
------------------------------------------------------------
--------TTVQELPPVVVSVPQEPP-QEAAKGDGDYDVVELDASELLAEHVHFCDICGK
G-----------------------------------------------------------
-------------------------FRRDANLRMHMRAH-GDRFKTLDAL-SRPGQPKPP
-------AGR-EVRFSCPYAGCNRNRAHRRFRPLKSAVCARNHFRRSH-CPKLYACERCG
GKKRFAVLADLRSHLRH-------------------------------------------
------------------------------------------CGEEAQWRCS-CGTTFS-
R--------------KDKLFGHLALFEGHTPAIA--------------------------
--------------EPNKGVA---------------------------------------
------------------------------------------------------------
------------------TAAAEASISMM-------------------------------
EEG-----------GVEA--------------NCDREE----------------------
------------------------------------------------------------
------------------------------------------------------------
--------DEEGGFDPK---F---------------------------------------
------------------------------FQEWMEELRGGA-VAP-----------N--
--------------------------------WSAPSE------------AGH
>gi|126321202|ref|XP_001376491.1|	   543 residues, 50 /line  PREDICTED: similar to novel KRAB box and zinc finger, C2H2 type domain containing protein [Monodelphis domestica]
----------------MATLCPLKDLPVVSKNE-----MFQVKTHKRFTLDL--------
---E--------FIKRSTPTFTDEPNQVI--KERKWAIDPFDLDYNDFAPLMKELLMKRE
CNKFIEETRSDPLLVLWPERYNV----NMSNKQIYDEMKEDRNEEQDSVVKDLKRKLREA
ELKAKDSEMKEVKAVSALRYLQPRNTYRSNLVSTENELDSIYPIPEDILEDLWSTSFTDV
GLLKSATPVKPGALPSPKSWDSGAGPGWLGFGEDQDGQ----------------------
RQG----------ANFLQVPTSQAGGTALPDSLLGLGSDSLALGS-------SDPKSSPQ
EELTFKDVAVDFTREE--------------------WH-----------LLSPSQKKLYK
EVML--ENARNLLSVGKEPSL---EN-YELSPAFS-----KENAPEPNVQKPYECKQCRK
TFSRSSNLVIHQRIHTGEKPYECNQCGKAFSMSSSLAAHQKIHTGEKPYECKQCGKTFSR
SSNLVIHQRIHTGEKPYECNQCGKAFSMSSSFAVHQKIHT--------------------
-------------------------------------------------GEKPYECNQCG
--KTFSMSSSLTAHQRIHTGEKPYGCNQ--------------------------------
-----------------------------------------------------CGKAFS-
Q--------------SSSLAVHQKIHTAHRI-----------------------------
--------------DDEGMKI---------------------------------------
------------------------------------------------------------
------------------VEGE--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------E---G---------------------------------------
------------------------------EIEGVEEEL------------------V--
--------------------------------NNYEAE--------------N
>gi|140053392|gb|ABE79513.2|	   366 residues, 50 /line  Peptidase S26A, signal peptidase I; F-box protein interaction domain; Zinc finger, C2H2-type [Medicago truncatula]
----------------MQMKCVCKSWNTLISEPFFVKMHLKEYNTVKMHLNY--------
---Q--------VMKRS----ARNPNLALPIRKRQKYTTPW---FCGVVPIPYQYLIYSR
INQ-------SPLLGYHP---RS----GFLIGSYNGLLHFREPQNTHKVVA---------
-------------------------FRPGGLEVKVFNLGDN-------------------
-------------------------------IRRDIQSLPVIPYFEINEGVYFSGSIHWL
ALY----------NYSHSLYEWAGITIDQFAIIISLNLSTETYNKLLLPRGFNEVTREVP
ILRVLNNHLCFSHEFK--------------------GTHLIIWQMTKYGVEE--------
---------SWNQLL---------KI-SHQNLPNPEAEVISLSPKPLMATNRFVCEICLK
D-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLKQR-----------
-TSKK---IR-KRVYVCPEKIR---VHNHPSRALGDLTGIKKHFCRKH-GEK-----KCS
--KFYVVQSDWKAHS---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>gi|146455139|dbj|BAF62149.1|	   499 residues, 50 /line  C2-H2 zinc finger protein [Arabidopsis thaliana]
-----METEDDL------------------------------CNNNWGSSSS--------
---KSREPGSSDGGNSTFAGFT---------SQQKWEDASILDYEMGVEPGLQENIQANV
--DFLQGVRAQ-------------------------------------------------
------------------------------------------------------------
-----AWDPRTMLSNLSF-------------MEQKIHQLQDLVHLLVGRGGQVQGRQDEL
AAQQQQLITTDLTSIIIQLISTAGSLLPSVKH--NMSTAPGPFTG-------QPGSAVFP
Y-VREANNVASQSQNN--------------------NNCGAREFDLPKPVLVD-------
------EREGHVVEEHEMKDEDD-VE-EGENLPPGSYEILQLEKEEILAPHTHFCTICGK
G-----------------------------------------------------------
-------------------------FKRDANLRMHMRGH-GDEYKTAAAL-AKPNKESVP
-GSEPM---L-IKRYSCPFLGCKRNKEHKKFQPLKTILCVKNHYKRTH-CDKSFTCSRCH
-TKKFSVIADLKTHEKH-------------------------------------------
------------------------------------------CGKN-KWLCS-CGTTFS-
R--------------KDKLFGHIALFQGHTPAIPL-------------------------
-----------EETKPSASTS---------------------------------------
------------------------------------------------------------
------------------TQRGSSEGGNN-------------------------------
NQGMVGF-----NLGSAS--------------NANQET----------------------
------------------------------------------------------------
------------------------------------------------------------
--------TQPGMTDGR---ICFEESFSPM-----------NFDTCNFGGFHEFPRLMFD
DSESS-------------------------FQMLIANACGFS-PRN-----------V--
--------------------------------GESVSD------------TSL
>gi|147772174|emb|CAN64546.1|	   390 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------------------
------------------------------------------------------------
------------------MIPVG----TSNCFVNGSQGLQMYGMTAEGSVSS--------
---------------------------------------------SLGGSSV-------L
EAH-----SCSLVYSFSI-------------LKDKVHQVQSLISIFVPPNQGQPE-----
---SMAMAVAGMGNLIQEVIAAASSMMYSCQQM-GYGAAPGNSGT-------NHGLPQQG
VELSDGRVCGDTGVVQMG--------EERGQGFYSSDQSLDWYGDNHNNSNTNDHSRTII
VSNN--DKVESRELPQGSTQMN---E-GLGGVXPKTFDIVELDAEDLLAKYTHYCQICGK
G-----------------------------------------------------------
-------------------------FKRDANLRMHMRAH-GDEYKSNAALSNPTKNIGRE
MENKDDLIKL-PRKYSCPQEGCRWNRKHAKFQPLKSMICVKNHYKRSH-CPKMYICKRCN
-QKQFSVLSDLRTHEKH-------------------------------------------
------------------------------------------CGDL-KWLCS-CGTTFS-
R--------------KDKLMGHVALFVGHTPAIN--------------------------
--------------SMSKPI----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------KFHQNASRL------------------------------
------------------------------------------------------------
----------------------------------------------------Q
>gi|2598167|gb|AAD12728.1|	   506 residues, 50 /line  zinc finger protein [Homo sapiens]
-----MTK--------FQEAVTFKDVAVAFTEE-----ELGL-------LDS--------
---AQRK-LYRDVMLENFRNLVSVGHQSF-------KPDMISQLEREEKLWMKELQTQR-
-GKHSGDRNQNEMATLHKAGLRCFSLGELSCWQIKRHIASKLARSQDSTINIEGKSSQFP
KHHDSPCQVGAGESIQA----SVDDNCLVNHIGDHSSIIENQEFPTGKVPNSWSKIYLN-
ETQNYQRSCKQTQMKNKLCIFAPYVDIFSCI-----------------------------
------------------------------------------------------------
------------------------------------------------------------
---------SHHHDDNIVHKRDKVHSNSDCGKDTLKVSPL-TQRSIHTGQKTYQGNECEE
AFNDSSSLELHKQVHLGKKSPACSTHEKDTSYSSGIPVQQSVRTGKKRYWCHECGKGFSQ
SSNLQTHQRVHTGEKPYTCHECGKSFNQSSHLYAHLPIHT--------------------
-------------------------------------------------GEKPYRCDSCG
--KGFSRSTDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQAHERIHTGEKPYKCGDCGKR
FSCSSNLHTHQRVHTEEKPYKCDECGKCFSLSFNLHSHQRVHTGEK-PYKCEECGKGFS-
S--------------ASSFQSHQ-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>gi|30688719|ref|NP_197680.2|	   373 residues, 50 /line  zinc finger (C2H2 type) family protein [Arabidopsis thaliana]
-----------------------MHIHMMNRDEHIA-------KKVEGSISS--------
---FSGETSTS-------------------------------------------------
-------------------------------------------SKQIYVNPV--------
---------------------------------------------TTTGTKS------ME
DDDV----SLSLLYNLST-------------LHEKVHQIQSLVSFYMVST-----NNINQ
SSGSTSLAVANIGSLVQEIITAASSMLYTCQQL-QIGSNNNNNDI-------DNDQTVDA
MVLEFSRQETDPGHDFVQESTNLFGVQERGQISF-PDQNLDWY-----------------
------------NTETINPKKDKH----RSKPSSGSYDILELDVADLLAKYTHYCQICGK
G-----------------------------------------------------------
-------------------------FKRDANLRMHMRAH-GDEYKTREALI-SPTSQDKK
-GG---YSLK-KHYYSCPQHGCRWNQRHEKFQPLKSVICAKNHYKRSH-CPKMYMCRRCS
-VKHFSVLSDLRTHEKH-------------------------------------------
------------------------------------------CGDI-KWVCS-CGTKFS-
R--------------KDKLMSHVSLFLGHVPAHGS-------------------------
-------------SKPPTITL---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------K
>gi|34534779|dbj|BAC87108.1|	   538 residues, 50 /line  unnamed protein product [Homo sapiens]
-----MTK--------SKEAVTFKDVAVVFSEE-----ELQL-------LDL--------
---AQRK-LYRDVMLENFRNVVSVGHQS--------TPDGLPQLEREEKLWMMKMATQR-
-DNSSGAKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQDSVVNIQRTGCQLE
KRDDLHYK--DEGFSNQSSHLQVH------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------RVHTGEKPYKGEHCVKSFSWSSHLQINQRAHAGEKPYKCEKCDN
AFRRFSSLQAHQRVHSRAKSYTNDASYRSFSQRSHLPHHQRVPTGENPYKYEECGKNVGK
SSHCQAPLIVHTGEKPYKCEECGVGFSQRSYLQVHLKVHA--------------------
-------------------------------------------------GKKRYKCEECG
--KSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIHCRIHTGEKPYKCEECGKG
FSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEK-PYQCDACGKGFS-
R--------------SSDFNIHFRVHTGKNPINVR-------------------------
-----------SV-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------ARAS----------------------
------------------------------------------------------------
------------------------------------------------------------
--------ARPQIFWPI---K--EATLERN-----------PTNVVHVGRASVGAQILMY
TVEST--------------------------QERNPINARSV-VRPSVS--SPAFRCI--
--------------------------------REFTLE-RNHISVQSVGRASV
>gi|81295397|ref|NP_001032289.1|	   437 residues, 50 /line  zinc finger protein 94 [Rattus norvegicus]
-------------------MVTFRDVAVVFSEE-----ELGL-------LDA--------
---AQRK-LYGEVMLENFRMLLSVG-----------------------------------
------GKNLEDTESLEEVGLRHLPHEELFCSQIWQRVIRELAKARDCRVRVGEHGSPVK
RDNRDDEEYSKH--SSQKSRLRLH------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------CGLNGGEEPDREERSEKD-SWDSRRQADGRSPVGEKRYRCEKCDL
SFCRLSGLQAHQVRHTGEKPYKCEECGKGFTRASTLLDHQRGHTGNKPYQCGACWKSFCH
SSEFNNHIRVHTGEKPYVCEECGKGFSQASHLLAHQRGHT--------------------
-------------------------------------------------GEKPYKCSTCG
--KGFSRSSDLNVHCRIHTGEKPYKCERCGKAFSRVSILQVHQRVHSEDKPYQCSECGKG
FSVESHLQAHQRSHTGERPYQCEECGRGFCRASNFLAHRGVHTGEK-PYQCDVCGKRFR-
Q--------------RSYLHDHHRIHTGRETVQMR-------------------------
-----------GV-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------WESLQL------------------ELI--
--------------------------------PQSPPE-S-PHGRETVQ---V
>gi|125563937|gb|EAZ09317.1|	   504 residues, 50 /line  hypothetical protein OsI_030549 [Oryza sativa (indica cultivar-group)]
----------------MLGSCAPTT------------------------AGP--------
---PPDEATTPEPFR-SLQIATASAGSA--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKKR-RPAGTPDPDAEVVSLSPRTLLESDRYVCEICNQ
G-----------------------------------------------------------
-------------------------FQRDQNLQMHRRRH-KVPWKLLKR-----------
-EAGE--AAR-KRVFVCPEPTC---LHHDPSHALGDLVGIKKHFRRKHSGHRQWACARCS
--KAYAVHSDYKAHLKT-------------------------------------------
------------------------------------------CGTR-GHSCD-CGRVFS-
R--------------VESFIEHQDTCNASRGQAAAVAEG-GN--VSTA-----ACGGVA-
--VL-EQEKQLDLQAPAAASLSRTASSTSPSSDVVASPVAWPGAW--APSMPSPKAAAF-
--------------RGRFDMAP--------------------------------------
------------SPPPPSYDHYRGGAGAH-------------------------------
NLELQLM--PPFNAGGAA--------------AAPGGMGACFYAAAH-------QHHPTG
VSQCNDASTQLQ----LSIGRGEVMGAAGTSDEA---SAA---ATAKEQAR---EQLRQA
MAEK-EAAGEARA------------QARRQVELAE-QELATAR-----------------
------RMRHQAQVELS---RAHALRD-------------------HAVR-QVNATLLQI
TCFSCRHKFRAAAAGAPLPAAMSSDVACSYVSSVVTEGGDAD-EPLDVV--DATRRRL--
--------------------------------QHANSMG------------IM
>gi|147787378|emb|CAN60092.1|	   425 residues, 50 /line  hypothetical protein [Vitis vinifera]
----------------MLENTA--A------------------------AST--------
---APSSSSDAF-------TSLENGVCN--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KRKR-RPAGTPDPDAEVVSLSPKTLLESDRYVCEICNQ
G-----------------------------------------------------------
-------------------------FQRDQNLQMHRRRH-KVPWKLLKR-----------
-ETQ---EVK-KRVFVCPEPSC---LHHDPLHALGDLVGIKKHFRRKHSNHKQWVCEKCS
--KGYAVQSDYKAHLKT-------------------------------------------
------------------------------------------CGTR-GHSCD-CGRVFS-
R--------------VESFIEHQDACAVRQVR----------------------------
--------PELQTLQPACS--SRTASSTSPSS-----DNNFSRVQLPGLTLPKPAETVF-
--------------LCLERNNP--------------------------------------
------------SP----------SDLQH-------------------------------
NLELRLL--PSPNTYSSR--------------NSDENHATHLKLSIG-------SCNSGE
MNEPRCA---------SGDASRSSPREMNTAEPA---LAA---SRLKELAS---EQLKLA
MAEK-ASAEEARR------------EAKRQIELAE-LEFANAR-----------------
------RIRQQAQAELE---KAQILKE-------------------QAIK-KVSSTILQI
TCHACKHQFQATAAGAP---SDETSLAMSYMSSALTEGEG--------------------
----------------------------------------------------E
>gi|140052210|gb|ABE80094.2|	   454 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------MSPKSLMATNRFLCEICNK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLKQR-----------
-ANKD--QIR-KKVYVCPEKTC---VHHEPSRALGDLTGIKKHYSRKH-GEKKWKCEKCS
--KKYAVQSDWKAHSKI-------------------------------------------
------------------------------------------CGTR-EYKCD-CGTIFS-
SCGQCNRKRSFDMVGKDSFITHRAFCDALTEQSAKITTV-P---AALS-----NFRNDH-
--LTNTQTPRIPHIFPG--FQFHSEFVNSATSSE----PPLGNYT--NISQLHQNSD---
---------------IMQTMDV--------------------------------------
------------FGSQPQW----LNYNNA-------------------------------
NLSLPMLHGVMKQEQEEN--------------KDLSASVISSLYLSR-------SQNQNQ
QEAP------NH----LSVTTSL-LQKESQMGST---RTI---ITND---N---NTVFNN
LNHF-HIVHEVQK------------FYNKQCESEELNELVNLE-----------------
--------GSNSSTNLG---GGYLLNDSNN-----------MFGIVNGTK-DLDHVVLSV
DKETTNRQMYDSGSRSKEKNQM------GFTRDFLGVGEDDS-MSRPFL--QQELGEF--
--------------------------------NGMGSLGNNLQSQYGNGH-YC
>gi|125542770|gb|EAY88909.1|	   534 residues, 50 /line  hypothetical protein OsI_010142 [Oryza sativa (indica cultivar-group)]
-----------------MANARAMR--------DGE-----------------MIDGDG-
---------------------------D--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------RSSV-RSRGGADPDAEVIALSPKTLLATNRFVCEICNK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLRQR-----------
-SGKE---VR-KRVYVCPEPTC---VHHDPSRALGDLTGIKKHFCRKH-GEKKWKCDKCS
--KKYAVQSDWKAHTKT-------------------------------------------
------------------------------------------CGSR-EYRCD-CGTLFS-
R--------------RDSFITHRAFCDALAEESAKARAA-PPPPADED-----GTSASAG
APPPQAPLPPPAPVPAPA-PPPPPAAAPAPAA----QPEQRDRDAALDQFAT--------
----------------------------PAPPPVTAPPPPPVAAPNDC-VSSSSSGV--A
PTSQSLLSSMF-APPSVAQAPQYADPI---------GVGAGGHQE---------------
------------------RAVPAKPPALCL---A--PNASSSLFTAPVPADRQQFAPPPP
PSPS------PH----MS-ATAL-LQKAAQMGAT---SSS---SSFL-------RCLGLD
MSSSSSAPPSSSGQQQQHHHHHHQETMQVPLPASSLPEWPPR------------------
--LQPEPSPMLSSGLGL--------GLPYD-----ATGGPVS------LPELMMGQ----
---------------STLFSAK------PATLDFLGLGVSPTGASTSRG--FPTFIQPIG
G---AVSLAGSATVAAETFGA--AHGGQAN----------PWERNPSSSP-IL
>gi|125564659|gb|EAZ10039.1|	   507 residues, 50 /line  hypothetical protein OsI_031271 [Oryza sativa (indica cultivar-group)]
------------MGATC-----------------------------------------GP
-----------------NPVVPTVLRGH--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------CDPA-STPSQQNPDAEVIALSPRTLMATNRFVCEVCNK
G-----------------------------------------------------------
-------------------------FQREQNLQLHRRGH-NLPWKLKQK-----------
-NPKE---AR-RRVYLCPEPSC---VHHDPSRALGDLTGIKKHYCRKH-GEKKWRCDKCS
--KRYAVQSDWKAHSKT-------------------------------------------
------------------------------------------CGTR-EYRCD-CGTLFS-
R--------------RDSFITHRAFCDALAQENARMPPI-G---AGVY-----GGAGNMT
LGLTGMAAPQLPA--------GFPDQAGQPS-ASAGDVLRLGGGSNGASQFD--------
----HL-MASSSGSSMFRS-QGSSSSSFYLANGAAHHAPAQDFGPEDG-QSQAGQGSLLH
GKPAAFHDLMQ-LPVQHQQSGNGNLLN--------LGF-FSGSNGG-------------V
DQFN---------GGAGNGGQGSIVTSSGL---AGNHGGGGGVF-----PS--LYNSSEP
AGTL------PQ----MS-ATAL-LQKAAQMGAT---TSS---YNAGGAGG-------AS
-----SLLRGASS------------HGI-SAGEGPAN-----------------------
--ERASYQNLIMGSMAS---GG-GGAGFAG-----SFSG---------------------
----ASGFG------GAVDDGK------LSTRDFLGVGVV------------QGISGSA-
AMGPPRH-------------------GAAG----------LHVGSLDPAN-MN
>gi|140070279|gb|ABO84216.1|	   446 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
------------MFPALMSNSTSFS--------EET-----------------NVSS---
--------ARLNHLV-STLNSSQQPQKT--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKKR-SLPGNPDPDAEVIALSPKTLLTTNRFVCEICNK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLKQR-----------
-NNKD--VIK-KRAYVCPEPSC---VHHNPSRALGDLTGIKKHYSRKH-GEKKWKCDKCS
--KIYAVHSDWKAHSKT-------------------------------------------
------------------------------------------CGTR-EYKCD-CGTLFS-
R--------------KDSFITHRAFCDALAEESARMSAN-Q---LAIT-----T-TNTNP
LVQSL-------------------------------------------------------
----------------------------------------------FL-FPNQQQSFQNP
QSHI-----TW-DPPQQNPNPSNLNNTLHHNIKPESPN-FHTNLSS--------------
PP------------------------PLPF---LHHTNPKSIMTSSPFHVS--TQQPSST
AAMS------PH----LS-ATAL-LQKAATVGAA---AIT---GSQPTMSH--------H
QTSQLSIGQFGSV------------TQLDSVDHYINN-----------------------
--MRGC------------------------------------------------------
---------------LTGKNDD------GLTRDFLGLTNGGGNGGDSLD--VKDMLTFTG
GVEYHQHQPHQNMMMLKSQSQ-QAGFGFLG----------TTTVPESWGN--C
>gi|87162706|gb|ABD28501.1|	   480 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
-----------------MSNLTSAS--------GEA-----------------SANSSGN
RTHEVDAKFSQQYFA-SSQTQTHDETPA--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKRR-NLPGNPDPQAEVIALSPKTLMATNRFICEICNK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHKRGH-NLPWKLKQR-----------
-TSNE---IR-KKVYVCPEPTC---VHHDPSRALGDLTGIKKHFCRKH-GEKKWKCDKCS
--KKYAVQSDWKAHSKT-------------------------------------------
------------------------------------------CGTR-EYRCD-CGTLFS-
R--------------RDSFITHRAFCDALAEESSRTVIP-Q-----PT-----Q-PNSHH
--NMN-------------------------------------------------------
----------------------------------------------NL-QTQDIQGFTLK
KEHQSFN--ML-RPEQEVQIPSWLCQS--------SID-LSSNYSS-------------L
DQ------------------------DLHL---YENPNPRNGPTST-------LPSYQPS
SAAS------PH----MS-ATAL-LQKAAQMGAT---SSC---SSQSMMSG-------TH
QQGHVSIVDSATN------------NMINSNGNFSLN-----------------------
--LSSCEDQMINNSFSS---SGFHGTSFED-----TFAGNILHSNQDHNINHDGDNDIPK
TT--TNDDD------VAAGGNN------AFTRDFLGLKPL--------S--DSDILTIAG
-MGSCMNPSNSNHQENHSQKP-WE---DYL----------RRMVGNLPTN--Q
>gi|92870471|gb|ABE79766.1|	   517 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
MVKGLMMFQQQQVVEENMSNLTSAS--------GEA-----------------SVSSG-N
RTEIGTSSSYPQVQQ-QYLVPPTQSQPM--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKKR-NLPGNPDPDAEVIAMSPKSLLAKNRFICEICNK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLKQR-----------
-TSKE---IR-KKVYVCPEPTC---VHHDPSRALGDLTGIKKHFSRKH-GEKKWKCEKCS
--KKYAVQSDWKAHSKT-------------------------------------------
------------------------------------------CGTR-EYRCD-CGTLFS-
R--------------RDSFITHRAFCDALAEESARAMTN-N---AM-P-----ILPSQQQ
LSSSSSHHHHMINLQNQF-NNPQQDLHNFPLLKKEQHNQSFNLSE---------------
------------------------------------------------------------
-------------------IPPWLGPH--------NVDNLSSSSSI-------------F
SQ------------------------HHHH---QENPNPSLVHVS-----G--PTLPSYQ
TVPS------AH----MS-ATAL-LQKAAQMGAT---MNR---SGSASSPA---MNIKTH
QVDSLNNVSGNFGLNLL---SSSQEQQQHQQNTQETNTTSTY------------------
--LNNIHDVMFSSSSSP---SGFEATHFDE-----MF-----GGIMNSKKDQNLHHETSL
SKKPTSTAEDGGGGGGGGGGNE------GLTRDFLGLRPL--------S--HSDILSIAG
-IGNCMNDQQ---QQNQSQKPSWQ----------------------------G
>gi|55418542|gb|AAV51391.1|	   518 residues, 50 /line  INDETERMINATE-related protein 7 [Zea mays]
------------MQPQQGSS----------------------------------------
--------SSLQQNS-TSAPGAAVVPPP--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKKR-NQPGNPNPDAEVIALSPRTLLATNRFVCEVCNK
G-----------------------------------------------------------
-------------------------FQREQNLQLHRRGH-NLPWKLKQK-----------
-NPRE---AR-RRVYLCPEPTC---VHHDPSRALGDLTGIKKHYCRKH-GEKKWKCDKCS
--KRYAVQSDWKAHSKT-------------------------------------------
------------------------------------------CGTR-EYRCD-CGTLFS-
R--------------RDSFITHRAFCDALARESAQMPPL-G---AGLY-----VGPGSMS
LGLSQIH--------------GFADQAQSSS-AAA------------APQFD--------
----HI-MPSSSGSSSMFRSQASASSPSYFLGGSAPPAAAQDFS-EDG--SQGSQGPLLH
GK-AHFHGLMMQLPEQQHQPGSSNAAVGANGSNILNLGFFSAGNSGGTSGSLQDARIAIQ
DQFN------LSGSGSGSAEHGNNVMVASI---GSH----------LGRGFPSLYSSS-P
SAGM------AQ----NS-ATAL-LMKAAQMGST---TSS---TTHNNHNG-PTTTSTLL
RATGF-SGATGSGQLGTTGGRAAAG------EEGAAS-----------------------
--HEAHFHELIMNSLAG---GGFSGT----------------------------------
-----------AGFGGGVDDGK------LSTRDFLGVGRGAA-TMAPPG--L--------
------------------------HMGALD----------PA------QQ-MK
>gi|140064565|gb|ABO82700.1|	   519 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
-----------M---VDLDNVSTAS--------GEA-----------------SISSSGN
N-----------------NIQSPIPKPT--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKKR-NLPGMPDPEAEVIALSPTTLLATNRFVCEICNK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLRQR-----------
-SSKE---IR-KRVYVCPEPTC---VHHDPSRALGDLTGIKKHFCRKH-GEKKWKCEKCS
--KKYAVQSDWKAHSKV-------------------------------------------
------------------------------------------CGSR-EYKCD-CGTVFS-
R--------------RDSFITHRAFCDALAEENAKSQNQ-AVGKANSE-----SDSKVLT
GDSLPAVITTTAA---AAATTPQSNSGVSSAL-----------------ETQ--------
----KLDL-------PENPPQII----------EEPQVV------VTTTASALNASCSSS
TSSKSN----------GCAATSTGVFA---------SLFASSTASA------SASLQPQA
PAFSDLIRSMGCTDPRPTDFSAPPSSEAIS--LCLSTSHGSSIFGTGGQ-ECRQ--YV-P
THQP------PA----MS-ATAL-LQKAAQMGAA---ATN---ASLLRGLGI---VSSSA
S--TSSGQQDSLHWGLG---PMEP---------------------------EGSSLVSAG
L-GLGLPC--------------------------DADSG---------LKELMLGT----
---------------PSMFGPK------QTTLDFLGLGMAAG-GSAGGG--LSALITSIG
GGSG------------------------LDVTAAAASFGNGEFSGKDIGR-SS
>gi|22329554|ref|NP_172910.2|	   467 residues, 50 /line  zinc finger (C2H2 type) family protein [Arabidopsis thaliana]
-----MSSSYNT---IALSSTPTFL--------LSS-----------------AAAGPGP
N--NFNRQEAAMTMV-QQQPTSSVAPPP--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKRR-NQPGNPNPDAEVIALSPKTIMATNRFLCEVCNK
G-----------------------------------------------------------
-------------------------FQREQNLQLHRRGH-NLPWKLKQK-----------
-SNKE---VR-RKVYLCPEPSC---VHHDPARALGDLTGIKKHYYRKH-GEKKWKCDKCS
--KRYAVQSDWKAHSKT-------------------------------------------
------------------------------------------CGTK-EYRCD-CGTIFS-
R--------------RDSYITHRAFCDALIQESARNPTV-SFTAMAAG-----GGGGAR-
HGFYGGASSALS--HNHFGNNPNS--GFTPLA-----------------AAG--------
----YNLNRSSSDKF--EDFVPQ----------ATNPNP----GPTNFLMQCSPNQGLLA
QNNQSL----------M---NHHGLI----------------------------------
--------------------------------------------------SL-----G-D
NNNN------NHNFFNLA-YFQD-TKNSDQTGVPSLFTNG---ADNNGPSAL---LRGLT
SSSSSSVV--VNDFG---------------------------------------------
DCDHGNLQGLMNSLAATTDQQGRSPSLFDLH---------------------FANN----
---------------LSMGGSD------RLTLDFLGVNGGIV-ST-------------VN
GRGG------------------RSGGPPLD-AEM------KFSHPNHPYG-KA
>gi|42475462|dbj|BAD10885.1|	   522 residues, 50 /line  zinc finger protein [Malus x domestica]
--MSIITGSAAT---GSFSSGNTGG--------EEVQQQQQELLNHHANFHGSNSLLPTT
P--NINSNGISTTQV-QK-----QPPPA--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKKR-NLPGTPDPTAEVIALSPKTLMATNRFVCEICKK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLKQR-----------
-TSTE---II-KRVYICPESSC---VHHDPSRALGDLTGIKKHFFRKH-GEKTWKCDKCS
--KKYAVQSDWKAHLKT-------------------------------------------
------------------------------------------CGTR-EYKCD-CGTIFS-
R--------------RDSFITHRAFCDAIAEENNRNQGV-VPMSNNIM-----GAPNQGQ
LSNSELIIPASPPMNNKITDNPSSARSDTTTS-----------------DQF--------
----HHNFDAKNAPLTLEPQQPF----------PMPTKP------VNMLPRTLSNNTSSS
TSPSSL----------LFGLNHGGHD----------------------------------
--------------------------------------------------QS-----L-I
PNSS------GH----LS-ATQL-LQKAAQMGAT---MSG---GPNPNPSGT---TITSM
APSTYGTA--TGGYNMN---PFMQQ--RDPNNILQLETSPQFFGA----NYAQMGMFSGM
LFDHAQNNGLLKNMEHENNGTSNKIG--------------------------FRGA----
---------------SNVGNGD------TLTVDFLGLGGSGN-NNRPEN--FHDLQKQQH
GQQD------------------QLGFGGID----------DHDDHLRMQR-FG
>gi|92882265|gb|ABE86660.1|	   530 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
--MSNIT-SCDS---GSFSTENTRE--------DAVKQQQTDQILGQFHSPHSHTSTTTN
N--NNNSN----------GSNTDLQPPL--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKKR-NLPGNPDPSAEVIALSPTTLMATNRFVCEICNK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLKQR-----------
-TSAE---IR-KRVYVCPEPSC---VHHNPARALGDLTGIKKHFCRKH-GEKKWKCDKCS
--KKYAVQSDWKAHSKI-------------------------------------------
------------------------------------------CGTR-EYKCD-CGTIFS-
R--------------RDSFITHRAFCDALAEENNKANEG-VLSNLQHQ-----PISNLVS
S----------LPLNP--INNPQICGTVSEFN-----------------NHS--------
----DHKLPLSSP----HELMSM----------SVPPKP----FNNNIFTRSLSSSTSSP
SLQLSS----------NNSLNNILEE----------------------------------
--------------------------------------------------NGSL--HL-S
AATS------PH----MS-ATAL-LQKAAQMGAT---VSN---NNAGIMTDKTTVATNMM
APPQFGLVQQQGHAFMN---HYMQQQQQHYNNNFNANGIINGGGV----GMNGVDMFNAI
L-DQSKAL----SKIIEQNNQTQSINSVVGGGGGGASSN---------SNNVMNIS----
---------------GSKGGGD------VMTLDLLGIGGGGA-HSNFY-----GGGTQQ-
-QAE------------------SAAAAAADEVWRNWSTKNGGFESFSATS-NI
>gi|55418546|gb|AAV51393.1|	   544 residues, 50 /line  INDETERMINATE-related protein 1 [Zea mays]
------MAAASS---AHLFGLGDGQ--------MQMQPQQQQ------------------
------------APP-PPLVNNPAAPPP--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKKR-NQPA--DPDAEVIALSPKTLMATNRFVCEVCNK
G-----------------------------------------------------------
-------------------------FQRDENLQLHRRGH-NLPWKLKQK-----------
-NPKE---TRLRRVYLCPEPTC---VHHDPSRALGDLTGIKKHYCRKH-GEKKWKCDKCN
--KRYAVQSDWKAHSKT-------------------------------------------
------------------------------------------CGTR-EYRCD-CGTLFS-
R--------------RDSFITHRAFCDALAQESARVPPM-GAGM---Y-----GTGGMA-
LGLSGMATSQLQSFQDQTHSSATTAISNNPTA-----------------QFE--------
----HLM-QSSTGSPVFRGAQPT----------SSSSSPFYLGGAEDGHQSLSGHTSLLH
GNKQAYHGLM-LLPEQQHQAGSNGLLN---------LGFFSGGSSG------QDARLVFP
DQFNGAVGGNVRGDGSEHGNSGANTESAAI--FSGNLMGNHQMASSAGF-SSSLYNSS-E
TAAP------AQ----MS-ATAL-LQKAAQMGAT---TSS---GNVNSLLRGLGSSAGG-
---TLNGRPAGAS---------------------------AGFMA----GESSSARSTSQ
AENESQFRDLMNTLAASG--SGAAGTAFSG------------------------GF----
---------------PGMDDSK------LSTRDFLGVGGSVV-RSMGG----AAGLPLRH
GGAA------------------GIGMGSLD------------------TE-MK
>gi|125570893|gb|EAZ12408.1|	   424 residues, 50 /line  hypothetical protein OsJ_002233 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------MATNRFVCEICGK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLKQR-----------
-GSKE--AVR-KKVYICPEASC---VHHDPSRALGDLTGIKKHFFRKH-GEKKWKCDKCS
--KKYAVHSDWKAHSKI-------------------------------------------
------------------------------------------CGTR-EYKCD-CGTIFS-
R--------------RDSFITHRAFCDALTEESAKAIGG-IPAAMAAP------------
------------------------------GHHHHHHHHHHQLLFSPPPVMA--HHQELA
ALQEQQQQQH--------------------HQDVMQSPHQH------QQQQQQR------
--------------QQLVQQNCGYARE---------AGDGA-------------------
---------------------------------VADDD---------------------A
LRPP------PP----AA-AAAL-QRQRRRHGAE---LGHVRATDDAAAA-----RRRRR
RAPVRHGAAAESREKLAHSF--AG----AGTGAPGGEKGPHGDGG----GGGGNGLIPAG
M-MGHLAR--------------------------TASHG---------RSGEDVAG----
---------------AGGGGGD------GMTRDFLGLRAFSH-RDILLAGFDSSCMGHVN
A---AAGMAGYEPPPPHHGQPQ-----HQHQQQQQQQQGGSNEPWHGMGS-HS
>gi|15219567|ref|NP_171880.1|	   506 residues, 50 /line  zinc finger (C2H2 type) family protein [Arabidopsis thaliana]
-----MTTEDQTI-SSSGGYVQSSS--------TTD------------------------
---------HVDHHH-HDQHESLNPPLV--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKKR-NLPGNPDPEAEVIALSPKTLMATNRFLCEICGK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLKQR-----------
-TSKE---VR-KRVYVCPEKSC---VHHHPTRALGDLTGIKKHFCRKH-GEKKWKCEKCA
--KRYAVQSDWKAHSKT-------------------------------------------
------------------------------------------CGTR-EYRCD-CGTIFS-
R--------------RDSFITHRAFCDALAEETARLNAASHLKSFAATAGSNLNYHYLMG
TLIPSPSLPQPPSFPFGP-----------PQPQHHHHHQFPITTNNFDHQDVMKPASTLS
LWSGGNINHHQQVTIEDRM-APQPHSPQEDYNWVFGNANNHGELITTSDSLITH------
--------------DNNINIVQSKENA---------NGATS-------------------
---------------------------LSVPSLFSSVDQ--------IT-----QDANAA
SVAV------AN----MS-ATAL-LQKAAQMGAT---SST---SPTTTIT--------TD
QSAYLQSFASKSNQIVEDGG--SD-RFFASFGSNSVELMSNNNNGLHEIGNPRNGVTVVS
G-MGEL-Q--------------------------NYPWK---------RRRVDIGN----
------------------AGGG------GQTRDFLGVGVQT--------------ICHSS
S---INGW--------------------------------------------I
>gi|9858780|gb|AAG01127.1|AF273333_12	   519 residues, 50 /line  BAC19.12 [Lycopersicon esculentum]
-----MPADPD---NSSAMNDSTGS--------GEA------------------------
---------SVSS-S-GNQVV-PLKESA--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------KKKR-NLPGMPDPDAEVIALSPTTLLATNRFVCEICSK
G-----------------------------------------------------------
-------------------------FQRDQNLQLHRRGH-NLPWKLRQR-----------
-SSNE---VK-KRVYVCPESSC---VHHDPSRALGDLTGIKKHFCRKH-GEKKWKCDKCS
--KKYAVQSDLKAHSKI-------------------------------------------
------------------------------------------CGTR-EYKCD-CGTLFS-
R----------------------AFCDALAQESAKTLPE-KPPSTNEE-----PKTQAVA
SSSPPPSPPAPPPATESQ-----------PPPPPPAAPKSLMTPTVPPSTAVMSFASS--
-----------VQNRELRE-NPVTNSAGAATKQVVEEAAVVASLTGN----CSS------
--------------SCSNGSSSSNVFG---------SLFASSTASGS--------LPSQA
PVFSDIFRAMA----PEHTLEMAPPSSTEPISLGLAMSHSSSIFRPAGQ-----ERRQYA
PAPQ------PA----MS-ATAL-LQKAAQMGAA---ATS---SSFL-------------
RGIGVMSSTSSSNGHQEWSGRPSD-ANGASLAAG--------------------------
L-GLGLPC--------------------------DAGSG---------LKELMLGT----
---------------PSVFGPK------HPTLDLLGLGMAAS-VGPSPG--LSALLTSMG
S---NLDM-----------------------VTSAGSFGSADFSGKDLGR-NS

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.