Fandom

Proteins Wiki

At2g01940.1/MSA

< At2g01940.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|79549667|ref|NP_178303.2|	   445 residues, 50 /line  SGR5 (SHOOT GRAVITROPISM 5); nucleic acid binding / transcription factor/ zinc ion binding [Arabidopsis thaliana]
-----------MRT--DQV-----------------------------------------
------------MLSNKN------------------------------------------
------------------------------------------------------------
---------TNTCCVVSS------------------------------------------
-----------------------------SS-----------------------------
---------------------SDPFLSSSENGV---------------------------
--------------------------TTTNTS-TQKR-----------------------
--------------------------------------------------------KRRP
AGTPDPDAEVVSLSPRTLLES----DR---------------------------------
---------------------------YI-------------------------------
-------------------------CEICNQGFQRDQNLQMHRRRHKVPWKLLKRDNNIE
VKKRVYVCPE--------PTCLHHNPCHALGDLVGIKKHFRRKHSNHKQWVCERCS--KG
YAVQSDYKAHLKT-CGTR-GHSCD-CGRVFSR--------------VESFIEHQDNCS-A
RR--VHREPP------------------------RPPQTAVTVPACS-------------
-----------------------SRTASTVSTPSSETNYGGTVAV-----TTPQPLEGRP
IHQRI-------------------------------------------------------
---SSS------ILTNSSNNLNLELQLLPLSSN---------------------------
---Q--NPNQENQQQKVKEP--SHHHNHNH-DTTNLN-----LSIAPSSSYQHYNNFD--
----RIKEIMASEQIMKIA-MKEKAYAEEAKRE-------------------------AK
RQREIAENEFANAKKIRQKAQAELERAKFLKEQS--------M-KKISSTIMQVTCQTCK
G----QFQAVAV--PAAT--------------------------------ADETSLVVSY
MSSANTD------------GEL--------------------------------------
------------------------------------------------------------
-ENG-F
>gi|109125885|ref|XP_001116675.1|	   481 residues, 50 /line  PREDICTED: similar to zinc finger protein 320 [Macaca mulatta]
----------------------------------------------------MA------
--------------LPQGLLTFRDVAIE--FSQ-------------E--EWKCLDPAQR-
------------------------------------------------------TLYR--
DVMLENY-----------RNLVSL--DIS---SKCMMNTLSSTGQGNTEVF------HTG
ILQRQ----A----SYHIGVLCSQEIEKNIHDFVFQWRE---------------------
---------DETNDHE---APVTEIKKLTGSTDRYD-QRLGGNKPIKDQL-G--------
-S----------S-----------------------------------------------
------------------------------------------------------------
------FHLHLRRHRRIHTGE----KPYKCKVCDKTFKHDSHLAQHTRIHRG---DKHYT
CNECGKVFDQKATLACHH-RSHTGEKPYRCNECGKTFSQTSHLVYHHRLHTGEKPYKCNE
CGKTFARNSVLVIHKAVHTAEKPYKCNECGKVFKQRATLAGHRRV---------------
--------------HTGEKPYRCEECDKLFSRKSHLERHRRIHT-GEKPYKCKVCD--KA
FRSDSRLAEHQRVHTGER-PYTCNECGKVFST--------------KAYLACHQKLHT--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
EKLYK----------CEECDKVYIRKSHLERHR--R------------------------
----IH------------------------------------------------------
------------------------------------------------------------
------------------------------------TGEKPHK-CDECGKAFNSPSHLIR
H----QRIHTGQKSY--K--------------------------------CRQCG-----
---------------------KVF---------------------------------SLR
SLLAEHQKIPFGDN------CFKCNEYSK---PS-----SI-------------------
-----N
>gi|109458333|ref|XP_218433.4|	   441 residues, 50 /line  PREDICTED: similar to zinc finger protein 112 [Rattus norvegicus]
------------------------------------------------------------
--------------MTRSFGWWRQTPKR--VGS-------------Q--DFPAVRPQGQP
-------------------------------------------HNRTC----CTSFGQ--
TLCLQGH-----------QKLHI----------REKPYKCSACGKGF-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----SHRRALQVHQRIHTGE----KPFKCGECGKGFSRSAYLQAHQRVHTG---EKPYK
CGECGKGFSRSAYLQGHQ-RVHTGEKPYKCEECGKGFSRSSHLQGHQRVHTGEKPYKCEE
CGKGFSWSFNLQIHQRVHTGEKPYKCGECGKGFSKASTLLAHERI---------------
--------------HTGEKPYQCHECGKNFSQKSYLQSHQSVHS-GERPYICEVCG--KG
FSQRAYLQGHQRVHTLVK-PYNCEVCGKGFSQ--------------GSRLEAHRRVHA--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
GKPYK----------CETCAKGFSESAGLQAHQ--RIHAEGRAYKCELCGKGFSGYSGLQ
AHQRVH------------------------------------------------------
------------------------------------------------------------
------------------------------------TGEKPYK-CEVCGKDFSQRSNLQA
H----QRVHTGEKPY--T--------------------------------CDACG-----
---------------------KGF---------------------------------RWS
SGLLVHQRAHSNDK------FCRNGEFRSSYLPE-----NL-----------------GR
NEG--L
>gi|131889944|ref|NP_001076468.1|	   524 residues, 50 /line  hypothetical protein LOC100009630 [Danio rerio]
----------------------------------------MDSVSVHSVYVLQQ------
-LQEQRIQGLLCDCMLVVKGVCFKAHKN--VLA---AFSSYFRSLFQ--NSPAQKSDVFH
-------------------------------------------LSIQD----VSGIGQ--
LLDYMYT-----------SHLEL---------NQENVHTLLEIGQSLQVLN------VLN
MCHAF----L----KPCVSADSASSCCVSAGPECVSGPG---------------------
-----------ASEPQ---EPPHTHKLRSFYSRQYL-QQSPAAGPAPSGP-G--------
-A----------PQHKKTLYVKKFNYLRSQEE-EEERC-------AGGHAPCG---PATP
SSADTTPSDLCVTSDLC------VTPDLCVTSDPAEAAEL--------------ERTPEA
EPGNTGPQGQEQRSGVSGGGG----NKYCCEVCGKTFKHP--------------------
-----------SNLELHK-RSHTGEKPFQCSVCGKAFSQAGNLQTHLRRHSGEKPYICEL
CGKSFAASGDVQRHIIIHSGARPHLCDVCGRGFSNFSNLKEHKKT---------------
--------------HRAEREFTCDQCGKSFNMQRKLLKHKSRHS-GDKPYCCQTCG--KC
FAGSGDLQRHVRSHTGER-PYVCDACGKSFSR--------------TAVLRRHRS-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------AGVCVSSTAAPECVCAPQRPGEVC
VSSEAA------------------------------------------------------
------------------------------------------------------------
------------------------------------PEPGPEE-----------------
------------------------------------------------------------
------------------------------------------------------------
--------------------LCSSGALWGRAM-------KT-----------------LQ
SD---L
>gi|147772174|emb|CAN64546.1|	   390 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------------------
-------------MIPVGTSNCFVNGSQ--GLQ---MYGMTAEGSVS--SSLGGSSVLEA
-------------------------------------------HSCSL------------
------V-----------YSFSI---------LKDKVH------------Q------VQS
LISIF----V----PPNQG---------QPESMAMAVAG---------------------
-----------MGNLI---QEVIAAASSMMYSCQQM-GYGAAPGNSGTNH-G--------
-L----------PQQGVELSDGRVCGDTGVVQ-MGEER-------GQGFYSSD---QSLD
WYGDNHNNSNTNDH---------SRTIIVSNNDKVESREL---------PQGSTQMNEGL
GGVXPKTFDIVELDAEDLLAK----YTHYCQICGKGFKRD--------------------
-----------ANLRMHM-RA----------------------------HGDEYKSNAAL
SNPTKNIGREMENKDDLIKLPRKYSCPQEGCRWNRK------------------------
-----------------------HAKFQPLKSMICVKNHYKRSH-CPKMYICKRCN-QKQ
FSVLSDLRTHEK-HCGDL-KWLCS-CGTTFSR--------------KDKLMGHVALFV--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
HTPAI-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------NSMSKPIKFHQ-----NA-----------------SR
L----Q
>gi|119602840|gb|EAW82434.1|	   465 residues, 50 /line  hCG2039195, isoform CRA_b [Homo sapiens]
----------------------------------------MRLKKAIHLKK---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------LNFLKSQKS-AEQVS-----EPKSDDGLTK---RLES
ASKNTLEKASSQSAEEK------ESEEVVSCENFNCISET--------------------
--ERPEDPAALEDQSQTLQSQ----RQYACELCGKPFKHP--------------------
-----------SNLELHK-RSHTGEKPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEI
CGKRFAASGDVQRHIIIHSGEKPHLCDICGRGFSNFSNLKEHKKT---------------
--------------HTADKVFTCDECGKSFNMQRKLVKHRIRHT-GERPYSCSACG--KC
FGGSGDLRRHVRTHTGEK-PYTCEICNKCFTR--------------SAVLRRHKKMHCKA
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------GD
ESPDV----------LEELSQAIETSDLEKSQSSDSFSQDTSVTLMPVSVKLPVHPV---
-----E------------------------------------------------------
------------------------------------------------------------
------------------------------------NSVAEFD-SHSGGSYCKLRSMIQP
H----GVSDQEKLSL--DPGKLAKPQMQQTQPQAYAYSDVDTPAGGEPLQADGMA-----
---------------------MIR---------------------------------SSL
AALDNHGGDPLGSRASSTTYRNSEGQFFSSMTLW-----GL-----------AMKTLQNE
NELD-Q
>gi|125535923|gb|EAY82411.1|	   478 residues, 50 /line  hypothetical protein OsI_036370 [Oryza sativa (indica cultivar-group)]
----------------------------------------MDRD--------QM------
--------------MNTMRDQAANLTSM--NPL---FYPFMADDALLGMAPPPPQQLLPS
-------------------------------------------VSIQH----MDWSPD--
TM----L-----------DNLTF---------IEEKIR------------Q------VKD
VIRSMAGRRA----SSSSA---------ATPEQQLVNAD---------------------
-----------LTCLI---VQLISTAGSLLPSLKNS-SFLSRTTPPPAAA-A--------
-G----------AAQAVSLAAGESSSSARNNE-TNRED-------EEEMGSPD-------
-YDELFKGWTNGGA---------MDEFVGAAGDEQDAREN---------PAAAAAAA---
-EEEEEKYEVLQLEEDEILAP----HTHFCGICGKGFKRD--------------------
-----------ANLRMHM-RG----------------------------HGDEYKSAAAL
AKPPPPPEGEEQPERR-------YSCP---------------------------------
--------------HAGCKRNRMHASFQPLKTILCVKNHYKRSH-CEKRHVCGRCG-AKR
FSVMADLKTHEK-HCGRD-RWLCS-CGTTFSR--------------KDKLFAHVALFQ--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
HAPAL----------PPPP-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------P-PPPTTTTSTAASGRRR
H----KQEET-EFTW--GGG----GGGDEFLDVKGIAGVGSGSGGGDEFFSAGSF-----
---------------------GAM---------------------------------DFG
--------FGQLDASLAMLLPSESEQ--------------------------FAGDHQEE
NGDD-K
>gi|125546364|gb|EAY92503.1|	   431 residues, 50 /line  hypothetical protein OsI_013736 [Oryza sativa (indica cultivar-group)]
-------------------------MVKCPYPALCFCLRWLVLQRRFHHRHGATLIFLTT
PGEGSYSSLLSTMMMSSSVDHFSNNSNN--NQA---MYLEQDEDFSQMIMELCDFDASST
-------------------------------------------TQARHGGEAAAGDAR--
AV----L-----------TYLTF---------LEQKIG------------H------LRG
II--------------SST---------PNPPPQIVAAE---------------------
-----------LSCIV---VQLVSISKNLAAAR---------------------------
----------------------------RGGD-DADAD-------AKHDGSSD-------
-------------------------ADEGGDGDGDGER----------------------
-APPRGPYEVVQIEKEEILAP----HVHFCGVCGKGFKRD--------------------
-----------ANLRMHM-RG----------------------------HGDEYKSSAAL
AKPD--AGGAPPSPSRSPARRRFYSCPYV-------------------------------
----------------GCKRNREHKSFQPLKTPICVKNHYRRSH-CDKSFTCRRCN-VKK
FSVVADLRTHEK-HCGRD-RWVCS-CGTSFSR--------------KDKLFAHVAIFD--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
HSPAL----------PPEDYDD--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------DAASGQLPHAAGEAVGRTVDTNRFFSDGLM----------
------------------------------------------------------------
--IKGSMDDERGTLSPMGLDYCEFDGIDLFAA----------------------------
AAFD-F
>gi|125562577|gb|EAZ08025.1|	   441 residues, 50 /line  hypothetical protein OsI_029257 [Oryza sativa (indica cultivar-group)]
--------------------------MASAERRIRM--WWRTAGRPKH------------
------------------------LWGR--RSM---LYMGHSRIYMDRYYDPIELHGQPP
PLLMIPGGGGGGGGGGGGISP-------YLVQSQHGHGGGVDGMEMEEGGGFMGEQPQCH
PL----L-----------YNLSV---------LKDRVQ------------Q------LHP
LVGLAV--------AHNAH---------AHGPLDVSAAD---------------------
-------------AII---QEIVAAASSMMYAFQLLCDLGTAPTTAPSQE-T--------
-A----------AASAVVVKNNDHAADAGQME-DDHLM----------------------
-----QQQWQQNGS---------RQHDYSSHAHAPPVFHS---------ETAAP------
AGATSATDTIIELDAAELLAK----YTHYCQVCGKGFKRD--------------------
-----------ANLRMHM-RA----------------------------HGDEYKSKAAL
SNP--TKLLAKGGDETMAAAARKYSCPQEGCRWNRR------------------------
-----------------------HAKFQPLKSVICAKNHYKRSH-CPKMYVCNRCG-RKH
FSVLSDLRTHEK-HCGDH-RWLCS-CGTSFSR--------------KDKLIGHVSLFA--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
HQPVM----------PLDAPRAGK------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------RQRSSSASVAGNIDDTTGIGMGA-----------
------------------------------------------------------------
------------------------------------------------------------
-----A
>gi|125582592|gb|EAZ23523.1|	   384 residues, 50 /line  hypothetical protein OsJ_007006 [Oryza sativa (japonica cultivar-group)]
------------------------------------------MKSTTHLL----------
------------------------------------------------------------
----------AGGGGGGSVAPPTAATAPTLAMEVGDPSGALVG--GAGGAGARGGDGDAR
DA----L-----------LRLVA---------LGDRMA------------A------VRR
RIAASI----------------------SGESGPLSSSD---------------------
-----------IHSVS---SEISSAAHLVVLNAASLLSSTVASLPAPPPP-P--------
-A----------------------------------------------------------
----------------------------TTVQELPPVVVS--------VPQEPPQE----
AAKGDGDYDVVELDASELLAE----HVHFCDICGKGFRRD--------------------
-----------ANLRMHM-RA----------------------------HGDRFKTLDAL
SRP-GQPKPPAGREVR-------FSCPYA-------------------------------
----------------GCNRNRAHRRFRPLKSAVCARNHFRRSH-CPKLYACERCGGKKR
FAVLADLRSHLR-HCGEEAQWRCS-CGTTFSR--------------KDKLFGHLALFE--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
HTPAI----------AEP-NKGVATAAAEASIS--MMEEGGVEANCD-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------REEDEEGG------------
------------------------------------------------------------
----------------------FDPKFFQEWMEE-----LRGGAVA------PNWSAPSE
A--G-H
>gi|147859485|emb|CAN81435.1|	   527 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----MDLKDRLSV--DTWTQSSSSGNELPKDQQSFTNFSLQQQQHQHKWEDPSVLDYSV
RIEP--------------------------AFQ---EFNQTSATSSSLPCN---------
PNSQIKN----------------------------LNREDCQMNEMLEPNRIQDWDPR--
VM----L-----------SNLSF---------LEQKIH------------Q------LQD
LVHLIVGRRSQVLGRTNEL---------VAQQQQLVTAD---------------------
-----------LTSII---VQLITTAGTLLPSVKNT-LSTASPSVGQLGQ-LGG------
VL----------FPSGTGMNGGGVAQSSGGSK----------------------------
VSDQSNQIDL-------------TGACVIEQNNATEEHEL----------KDEDDADEG-
ENLPPGSYEILQLEKEEILAP----HTHFCMICGKGFKRD--------------------
-----------ANLRMHM-RG----------------------------HGDEYKTPAAL
AKPNKESSSEPVL-------IKRYSCPFA-------------------------------
----------------GCKRNKDHKKFQPLKTILCVKNHYKRTH-CDKSYTCSRCN-TKK
FSVIADLKTHEK-HCGKD-KWLCS-CGTTFSR--------------KDKLFGHIALFQ--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
HTPAI----------PLDETKGSV------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------GPSDRGEGNGAANKVGSVGFNFSSNASSGSGVQDMMMD-----
------------------------------------------------------------
--VKRGADEPTGFFSPLTFDPCSLVGFHEFPRPPFEDSESSFSFLVPGSCSYTRKTGGES
SSNDLE
>gi|17223774|gb|AAL12167.1|	   444 residues, 50 /line  SNA2 [Patella vulgata]
-MPRAFLIKKRDKS--ESETQIFNPRSDNP------------------------------
-------------------PAAADVEED--EET---INVTDTDDTPMEVTESNLKSNEAT
-------------------------------------------LSPKVLVEEMPKPVV--
TP----V-----------PRLSP---------IQQKR-------------D------MYL
TGRSMEGIIKQ----TIVK---------PIPERPMIPVSLHLPPTPDCHRRLSPHSPADL
DRRTGSLSPVDSPSCS---PPEPARFHDPFPWQPPLISNLHSHPFLPFRF-FSGFPSPPL
PR----------NLNDSTLGFRPYAEVSSAFK-GPQLLPPPTYLPAGMRYPMN--FPQSP
NDTRKLFDDRRMDLDFS------VKMAKAPFDNVLNYSVV--------------------
TERPVPELELTEKKKSKENEP----IRYQCDSCKKSYSTFSGLSKHKQFHCASQIKKEFN
CKYCDKTYVSLGALKMHI-RTHT--LPCKCKLCGKAFSRP--------------------
------------------------------------WLLQGHIRT---------------
--------------HT-----------------------------GEKPFSCQHCG--RA
FADRSNLRAHLQTHSDVK-KYSCRSCSKTFSR--------------MSLLLKHEDGCCGT
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------V-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----VH
>gi|30685975|ref|NP_188724.2|	   412 residues, 50 /line  zinc finger (C2H2 type) protein (WIP4) [Arabidopsis thaliana]
-MLFS----TVLSH--RTLYILTCPNTLI------------------HSYTHPHIHAYLA
FTGFLTQLHHLEISCLL-------------------------------------------
-------------------------LLFFSLSSLLKLMADPDCIFRNGYVDYYNYSFNYA
TS----L-----------SRIYNS--HDS---FY----------------Y------PHQ
TTNPNINENPNLTS-----------------------------PDSPPLREALPLLSLS-
-------------PIH---KHQEPTANHHEYYFMETTET------SSNSN-FLDQCQDSY
RH-------DVTVDLHLGLPNLGDGGSSSSDV----------------------------
VLDSTDHQE---------------GHHDHHQDQGLEVTMA----------SDHDDEHGGL
QRGNHLHHFWIPTPSQILMGP----TQFSCPLCFKTFNRY--------------------
-----------NNMQMHM-WG----------------------------HGSQYRKG---
--------------------------PESLRGTQPTAMLKLPCYC---------------
--------C-----APGCKNNIDHPRARPLKDFRTLQTHYKRKH-GVRPFACRRCG--KA
FAVKGDWRTHEK-NCGK--LWYCS-CGSDFKH--------------KRSLKDHVKAF---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------GNGHVP-C--CG-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------IDHEEEEAAS-----DV-----------------EQ
Q----E
>gi|30688719|ref|NP_197680.2|	   373 residues, 50 /line  zinc finger (C2H2 type) family protein [Arabidopsis thaliana]
-----------------------------------MHIHM--------------------
--------------MNRDEHIAKKVEGS--ISS---FSGETSTSSKQIYVNPVTTTGTKS
----------------------------------------------------MEDDDVSL
SL----L-----------YNLST---------LHEKVH------------Q------IQS
LVSFYMVST-----NNINQ---------SSGSTSLAVAN---------------------
-----------IGSLV---QEIITAASSMLYTCQQL-QIGSNNNNNDIDN-DQ-------
------------TVDAMVLEFSRQETDPGHDF-VQE---STNLFGVQERGQISFPDQNLD
WYNT---------------------------------------------ETINPKKDKHR
SKPSSGSYDILELDVADLLAK----YTHYCQICGKGFKRD--------------------
-----------ANLRMHM-RA----------------------------HGDEYKTREAL
ISPTSQDKKGG-----YSLKKHYYSCPQH-------------------------------
----------------GCRWNQRHEKFQPLKSVICAKNHYKRSH-CPKMYMCRRCS-VKH
FSVLSDLRTHEK-HCGDI-KWVCS-CGTKFSR--------------KDKLMSHVSLFL--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
HVPAH----------GSSKPPT--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--ITLK
>gi|56784837|dbj|BAD82058.1|	   374 residues, 50 /line  putative zinc finger protein [Oryza sativa (japonica cultivar-group)]
-----MGLRTCSAM--EGEVVAASPFFEWLKPPPRPASSS--------------------
------------------------------------------------------------
-----------------SWSSSFSSSSSMASRDQETVVPGEDG-----GGEIQEDHKSGM
TC----L-----------PLLSM---------LEEGNS------------K------RHE
------------------------------------------------------------
------------------------------------HPVKEEIMSSAHAA-GV-------
------------VEPGVELNIGLPVTGSSAQE-VTMEE------DDEEEDDDDVGEEEMD
EWKPMHGGCKVEGDEEQ---YGEAVASVEGSSSITAV-------------GDMFGGVGAE
SGVAMSSRYWIPTPAQILVGP----VQFICHVCNKTFNRY--------------------
-----------NNMQMHM-WG----------------------------HGREYRKG---
--------------------------PESLKGTQTLAMLKLPCYC---------------
--------C-----AAGCKNNVAHPRARPLKDFRTLQTHYKRKH-GAKPFRCRRCA--KP
FAVKGDWRTHEK-NCGKR--WFCA-CGSDFKH--------------KRSLNDHVRSFG--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------A
HHLPV----------AESAAAAA-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------TTPA-----DK-----------------DR
IISFQR
>gi|81295397|ref|NP_001032289.1|	   437 residues, 50 /line  zinc finger protein 94 [Rattus norvegicus]
------------------------------------------------------------
------------------MVTFRDVAVV--FSE---E------------ELGLLDAAQRK
---------------------------------------------------------LYG
EVMLENF-----------RMLLSV--GGK---NLEDTESLEEVGLRHLPH----------
-----------------EELFCSQIWQRVIRELA-----------------------KAR
DCRVRVGEHGSPVKRDNRDDEEYSKHSSQKSRLRLHCGLNGGEEPDREER-S--------
------------------------------------------------------------
------------------------------------------------------------
--EKDSWDSRRQADGRSPVGE----KRYRCEKCDLSFCRLSGLQAHQVRHTG---EKPYK
CEECGKGFTRASTLLDHQ-RGHTGNKPYQCGACWKSFCHSSEFNNHIRVHTGEKPYVCEE
CGKGFSQASHLLAHQRGHTGEKPYKCSTCGKGFSRSSDLNVHCRI---------------
--------------HTGEKPYKCERCGKAFSRVSILQVHQRVHS-EDKPYQCSECG--KG
FSVESHLQAHQRSHTGER-PYQCEECGRGFCR--------------ASNFLAHRG-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----VH------------------------------------------------------
------------------------------------------------------------
------------------------------------TGEKPYQ-CDVCGKRFRQRSYLHD
H----HRIHTGRETV--Q--------------------------------MRGVW-----
---------------------ESL---------------------------------QLE
LIPQSPPESP------------------------------------------------HG
RETVQV
>gi|91094355|ref|XP_970090.1|	   405 residues, 50 /line  PREDICTED: similar to ATM/ATR-Substrate Chk2-Interacting Zn2+-finger protein [Tribolium castaneum]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MEKVYPSIDDLSNV----NKKSCPECSALFNSD--------------------
-----------SNLNLHLAKTHKKP-----------------------------KLLEPT
NP------------------NKIFYCPIT-------------------------------
----------------TCSY---HNTSH-FKQFKPLKQHFLKVH-SDKNFLCTLCQ--KG
FATESSRNKHTEY-CDV--AFKCCDCDVSYSC--------------YETLKTHSRRKKHN
ILEKVAYKTSLPPS--VKNPKSDD------SL--ATNRLRLILPKPS-------------
----------------NSTGMIDTSEQSVQTDKSNNSQETQTFLAAR---LPQFTVETQT
IGDYFT-----KKPVKSTELKNIKTQTIAPVAKTSSCNTLFNLDDFVLSVMEDMQRSSSS
TQTNI----------CEESENIYSASTST----HDSIHTDTSDLLNDTFDSNFFN-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------METQTDFDDLFK
Y----CDDYSNMYTQ--TCHELLLGKIGLNDTQTQTV-------------FDDVL-----
---------------------KSV---------------------------------ESQ
TVMSQFKVLPASCKDNATHMETQTDTHFMQMLEEI-------------------------
----NA
>gi|94376961|ref|XP_989321.1|	   543 residues, 50 /line  PREDICTED: similar to zinc finger protein 498 [Mus musculus]
------MLKERLEMAGDPQQQMGAPVVKLEKE----------------------------
-LPWGRGGEDSSPEAF--RLRFRQFRYQ--EAAGPQEALRELQELCRRWLRPELHTKEQI
LELLVLE------------------QFLTILPREFYTWIR--------------------
EHSPDSG-----------KALVAMVEELM---GSTEAKAVPCHAQGEQLVT------ALG
GASWQS--------GIHLGPVEVKPEW-----------GIPQGE-------------GVQ
SLGPSTTEQLS------QGPGDGTQAFQEQALPILHVGPGLPSVSARDQEMAAGFLAATS
Q---------GLGPFKDMTLGFPEEEWRHVA-------------PAQIDCFGE---YVDS
QDCGVLPGAGSKEKEAKPQQEDLKRAFVGLTSDGFGEADIQIPGPGGTCEQEPGSSGTSL
PGLPAPQHGVPL--PDTLNTHNSFWKPFQCPECGKGFSRSSNLVRHQRTHEE---EKSFG
CVECGKGFTLREYLTKHQ-RTHLGKRPYVCGECWKTFSQRHHLEVHQRSH----------
------------------TGEKPYKCSDCWKGFSRRQHLLVHRRT---------------
--------------HTGEKPYTCE-CGKSFSRNANLAVHRRAHT-GEKPYGCQVCG--KR
FSKGERLVRHQKIHTGRK-PYHCPACGRSFNQ--------------RSILNRHQKTQH--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------R
QEPPV-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----Q
>gi|125563937|gb|EAZ09317.1|	   504 residues, 50 /line  hypothetical protein OsI_030549 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------MLGSCA------------------------------------------
------------------------------------------------------------
---------PTTAGP-PP------------------------------------------
-----------------------------DE-----------------------------
---------------------ATTPEPFRSLQI---------------------------
--------------------------ATASAG-SAKK-----------------------
--------------------------------------------------------KRRP
AGTPDPDAEVVSLSPRTLLES----DR---------------------------------
---------------------------YV-------------------------------
-------------------------CEICNQGFQRDQNLQMHRRRHKVPWKLLKREAGEA
ARKRVFVCPE--------PTCLHHDPSHALGDLVGIKKHFRRKHSGHRQWACARCS--KA
YAVHSDYKAHLKT-CGTR-GHSCD-CGRVFSR--------------VESFIEHQDTCN-A
SRGQAAAVAEGGNV--STAACGGV------AVLEQEKQLDLQAPAAA-------------
---------------------SLSRTASSTS-PSSDVVASPVAWPGAWAPSMPSPKAAAF
RGRFDM-----APS---------------------------------------------P
PPPSYD------HYRGGAGAHNLELQLMPPFNA---------------------------
---GGAAAAPGGMGACFYAA--AHQHHPTGVSQCNDASTQLQLSIGRGEVMGAAGTSDEA
SAAATAKE-QAREQ-LRQA-MAEKEAAGEARAQ-------------------------AR
RQVELAEQELATARRMRHQAQVELSRAHALRDHA--------V-RQVNATLLQITCFSCR
H----KFRAAAAGAPLPA--------------------------------AMSSDVACSY
VSSVVTE------------GGDAD---------------------------------EPL
DVVDATRRRLQHAN----------------------------------------------
-SMGIM
>gi|147787378|emb|CAN60092.1|	   425 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------------------
------------MLENTA------------------------------------------
------------------------------------------------------------
---------AASTAP---------------------------------------------
------------------------------------------------------------
-------------------------SSSSDAFT---------------------------
--------------------------SLENGV-CNKR-----------------------
--------------------------------------------------------KRRP
AGTPDPDAEVVSLSPKTLLES----DR---------------------------------
---------------------------YV-------------------------------
-------------------------CEICNQGFQRDQNLQMHRRRHKVPWKLLKRETQE-
VKKRVFVCPE--------PSCLHHDPLHALGDLVGIKKHFRRKHSNHKQWVCEKCS--KG
YAVQSDYKAHLKT-CGTR-GHSCD-CGRVFSR--------------VESFIEHQDACA-V
RQ--------------------------------VRPELQTLQPACS-------------
-----------------------SRTASSTS-PSSDNNFSRVQLPGL---TLPKPAETVF
LCLERN-----NP-----------------------------------------------
--------------SPSDLQHNLELRLLPSPNT---------------------------
---YSSRNSDENHATHLKLS--IGSCNSGEMNEPRCA-----SGDASRSSPREMNTAEPA
LAASRLKE-LASEQ-LKLA-MAEKASAEEARRE-------------------------AK
RQIELAELEFANARRIRQQAQAELEKAQILKEQA--------I-KKVSSTILQITCHACK
H----QFQATAAGAP-----------------------------------SDETSLAMSY
MSSALTE------------GEG--------------------------------------
------------------------------------------------------------
-----E
>gi|140052210|gb|ABE80094.2|	   454 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------MSPKSLMAT----NR---------------------------------
---------------------------FL-------------------------------
-------------------------CEICNKGFQRDQNLQLHRRGHNLPWKLKQRANKDQ
IRKKVYVCPE--------KTCVHHEPSRALGDLTGIKKHYSRKH-GEKKWKCEKCS--KK
YAVQSDWKAHSKI-CGTR-EYKCD-CGTIFSSCGQCNRKRSFDMVGKDSFITHRAFCD-A
LTEQSAKITTVPAA--LSNFRNDH------LTNTQTPRIPHIFPGFQ-------------
-----------------------FHSEFVNSATSSEPPLGNYT--NISQLHQNSDIMQT-
-----M-----DVF---------------------------------------------G
SQPQW----------LNYNNANLSLPMLHGVMK---------------------------
---QEQEENKDLSASVISSLYLSRSQNQNQQ------EAPNHLSVTTSLLQKESQMGSTR
------TIITNDNNTVFNN-LNHFHIVHEVQKF-------------------------YN
KQCESEE-LNELVNLEGSNSSTNLGGGYLLNDSNNMFGIVNGT-KDLDHVVLSVDKETTN
R----QMYDSGSRSK--E--------------------------------KNQMGFTRDF
LGVGEDDSMSRP---FLQQELGEF---------------------------------NGM
GSLGNNLQSQYGNG----------------------------------------------
-HY--C
>gi|140053392|gb|ABE79513.2|	   366 residues, 50 /line  Peptidase S26A, signal peptidase I; F-box protein interaction domain; Zinc finger, C2H2-type [Medicago truncatula]
------------------------------------------------------------
------------MQMKCVCKSWNTLISEPFFVKM---------------HLKEYNTVKMH
---------------------------------------------------------LNY
QVMKRSARNPNLALPIRKRQKYTT--PWFCGVVPIPYQYLIYSRINQSPLLGYHPRSGFL
IGSYNGLLH-----FREPQNTHKVVAFRPGG-----------------------------
---------------------LEVKVFNLGDNIRRDIQSLPVIPYFEINEGVYFSGSIHW
LALYNYSHSLYEWAGITIDQFAIIISLNLSTE-TYNKL----------LLPRGFNEVTRE
VPILR-VLNNHLCFSHEFKGTHLIIWQMTKY---------------GVEESWNQLLKISH
QNLPNPEAEVISLSPKPLMAT----NR---------------------------------
---------------------------FV-------------------------------
-------------------------CEICLKDFQRDQNLQLHRRGHNLPWKLKQRTSK-K
IRKRVYVCPE--------KIRVHNHPSRALGDLTGIKKHFCRKH-GEK-----KCS--KF
YVVQSDWKAHS-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|34785742|gb|AAH57364.1|	   530 residues, 50 /line  EG210583 protein [Mus musculus]
ESEGSSSVSRALSC--DRLLGAVRRAGEL-------------------------------
------------GIRAMDAVTYEDVYVK--FTHE---------------EWALLDPSQKS
---------------------------------------------------------LYK
DVMLETC-----------RNLTAI--GYKLQDDNIEEHCPSSRGCGRYNIYGYKPCEHKG
YGKKQCTFAQK-RFLQTYERICSEEKPYECN-----------------------------
---------------------QCSKAFANFRSLQKHEKNHTREKPYECN-----------
------------------------------------------------------------
-----------------------------------------------------------H
CGKAFPSRSALQIHQRTHTGE----KPFDCSECGKAFARHSNLDIHKRTHTG---EKPYD
CNECGKAFSTRSHLQIHE-IIHTGEKPYVCNQCGKAFAYRSNLEAHEKTHTGEKPYECNQ
CGNVYASRSSLRNHEKHHTGEKLYGCNQCGKAFARRSSLEIHERTHTGEKPYVCNQCC-K
AFARRSSLQIHERSHTGEKPYECNQCGKAFASRTSLQNHEKHHT-GEKPYGCNQCD--KA
FELKCDLQIHERIHTGEK-PYVCNQCGKAFVSRRYLRNHEKHHT----------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------L
EKLYD----------CSQCGKSFAIFRYLQKHK---------------------------
---KTH------------------------------------------------------
------------------------------------------------------------
------------------------------------TGEKPYK-CTHCGKAFAYRSNLYR
H----ERSHTGEKLY--E--------------------------------CNECG-----
---------------------KAF---------------------------------AYH
TSLHNHKKCHIGEN----------------------------------------------
-PYECN
>gi|125542770|gb|EAY88909.1|	   534 residues, 50 /line  hypothetical protein OsI_010142 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
-------------MANARAMR---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------DGEMIDGDG------------------------
----------------------------------DRS-----------------------
--------------------------------------------------------SVRS
RGGADPDAEVIALSPKTLLAT----NR---------------------------------
---------------------------FV-------------------------------
-------------------------CEICNKGFQRDQNLQLHRRGHNLPWKLRQRSGKE-
VRKRVYVCPE--------PTCVHHDPSRALGDLTGIKKHFCRKH-GEKKWKCDKCS--KK
YAVQSDWKAHTKT-CGSR-EYRCD-CGTLFSR--------------RDSFITHRAFCD-A
LAEESAKARAAPPP--PADEDGTSA---S--AGAPPPQAPLPPPAPVPAPAPPPPPA---
--AAPAP----AAQPEQRDRDAALDQFATPAPPPVTAPPPPPV-----AAP---------
---------------------NDCVSSSSSGVAPTSQ-SLLSSMFAPPSVA---------
QAPQYADPIGV----------------------GAGGHQ-ERAVP---------------
----AKPPALCLAPNASSSLFTAPVPADRQQFAPPPPPSPSPHMSATALLQKAAQMGATS
------SSSSFLRCLG------------LDMSSSSS---APPSSSG------------QQ
QQHHHHH-HQETMQVPLPASSLPEWPPRLQ-----PEPSPMLSSGLGLGLPYDATGGPVS
--LPELMM-GQSTL------------------------------------FSAKPATLDF
LGLGVSPTGASTSRGF-PTFIQPIGGA---VSLAGSATVA---AETFGAA--------HG
GQANPWERNPSSSP----------------------------------------------
-I---L
>gi|125564659|gb|EAZ10039.1|	   507 residues, 50 /line  hypothetical protein OsI_031271 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
----------------MGATCGPNPVVPTVL-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------RGHCD-----------------------
--------------------------------------------------------PAST
PSQQNPDAEVIALSPRTLMAT----NR---------------------------------
---------------------------FV-------------------------------
-------------------------CEVCNKGFQREQNLQLHRRGHNLPWKLKQKNPKE-
ARRRVYLCPE--------PSCVHHDPSRALGDLTGIKKHYCRKH-GEKKWRCDKCS--KR
YAVQSDWKAHSKT-CGTR-EYRCD-CGTLFSR--------------RDSFITHRAFCD-A
LAQENARMPPIGAG--VYGGAGNMT---LGLTGMAAPQLPAGFPDQAGQPSASAGDVLR-
LGGGSNG----ASQFDHLMASSSGSS-MFRSQGSSSSSFYLAN-----GAAHHAPAQDFG
PEDGQSQAGQGSLLHGKPAAFHDLMQ-LPVQHQQSGN----------GNLL---------
NLGFFSGSNGGVDQFNGGAGNGGQGSIVTSSGLA--------------------------
----------------GNHGG--GGGVFPSLYNSSEPAGTLPQMSATALLQKAAQMGATT
------SSYNAGGAGGAS---SLLRGAS----------------SHGISAG-------EG
PANERAS-YQNLIMGSMA-----------S-----GGGGAGFAG------------SFSG
-----ASG-FGGAV------------------------------------DDGKLSTRDF
LGVG--------------VVQG----------ISGSAAMGPP---------RHGAAGLHV
GSLDPA-------N----------------------------------------------
-M---N
>gi|140070279|gb|ABO84216.1|	   446 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
------------------------------------------------------------
----MFPA----LMSNSTSFS-EETNVSSA------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------RLNHLVSTLNSSQQ-----------------------
------------------------------PQ-KTKK-----------------------
--------------------------------------------------------KRSL
PGNPDPDAEVIALSPKTLLTT----NR---------------------------------
---------------------------FV-------------------------------
-------------------------CEICNKGFQRDQNLQLHRRGHNLPWKLKQRNNKDV
IKKRAYVCPE--------PSCVHHNPSRALGDLTGIKKHYSRKH-GEKKWKCDKCS--KI
YAVHSDWKAHSKT-CGTR-EYKCD-CGTLFSR--------------KDSFITHRAFCD-A
LAEESARMSANQLA--ITTTNTNP------LVQSL-----FLFPNQQQS-----------
---------------------------------------------------FQNPQSHIT
WDPPQQNPNP---SNLNNTLHH------NIKPESPNF----------HTN----------
-----LSSPPPLPFLHHTNPK--SIMTSSPFHVS--------------------------
-----------------------------TQQP-SSTAAMSPHLSATALLQKAATVGAAA
------ITGSQPTMSHHQ------------------------------------------
-----------TSQLSIG-----------Q-----FGSVTQLDS----------VDHYIN
-----NMR-GCLTG------------------------------------KNDDGLTRDF
LGLTNGGGNGGDSLDV-KDMLTFTGGVEYHQHQPHQNMMMLKSQSQQAGFGFLGTTTVPE
S----W-------G----------------------------------------------
-N---C
>gi|20258823|gb|AAM14021.1|	   455 residues, 50 /line  putative zinc finger protein [Arabidopsis thaliana]
----------------------------------------MMMNRD---------ILFHQ
QQQQQMEE----NMSNLTSASGDQASVSSGN-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------RTETSGSNINQHHQE----------------------
--------------------------QCFVPQSSLKR-----------------------
--------------------------------------------------------KRNQ
PGNPDPEAEVMALSPKTLMAT----NR---------------------------------
---------------------------FI-------------------------------
-------------------------CEVCNKGFQRDQNLQLHKRGHNLPWKLKQRSNKDV
VRKKVYVCPE--------PGCVHHHPSRALGDLTGIKKHFFRKH-GEKKWKCEKCS--KK
YAVQSDWKAHAKT-CGTK-EYKCD-CGTLFSR--------------RDSFITHRAFCD-A
LAEESARAMPNPIM--IQASNSPH------HHH---------------------------
----------------------------------------------------HQTQQNIG
FSSSSQN------IISNSNLHG------PMKQEESQH----------H------------
-----YQNIPPWLISSNPNPNGNNGNLFPPVASS--------------------------
-----------------------------VNTGRSSFPHPSPAMSATALLQKAAQMGSTK
------STTPEEEERSSR---SSYNNLI----------------TTTMAAMM------TS
PPEPGFG-FQDYYMMNHQ-----------H-----HGGGEAFNG------------GFVP
-----GEE-KNDVV------------------------------------DDGGGETRDF
LGLRSLMS--------------------HNEILSFANNLGNC---------LNTSATAQQ
QQQH-S-------H----------------------------------------------
-Q---D
>gi|55418542|gb|AAV51391.1|	   518 residues, 50 /line  INDETERMINATE-related protein 7 [Zea mays]
----------------------------------------------------------MQ
PQQGSSS-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------SLQQNSTSAPGAAV-----------------------
------------------------------VP-PPKK-----------------------
--------------------------------------------------------KRNQ
PGNPNPDAEVIALSPRTLLAT----NR---------------------------------
---------------------------FV-------------------------------
-------------------------CEVCNKGFQREQNLQLHRRGHNLPWKLKQKNPRE-
ARRRVYLCPE--------PTCVHHDPSRALGDLTGIKKHYCRKH-GEKKWKCDKCS--KR
YAVQSDWKAHSKT-CGTR-EYRCD-CGTLFSR--------------RDSFITHRAFCD-A
LARESAQMPPLGAG--LYVGPGSMS---LGLSQI------HGFADQAQSSSAAA------
-----------APQFDHIMPSSSGSSSMFRSQASASSPSYFLG-----GSAPPAAAQDFS
-EDG-SQGSQGPLLHGK-AHFHGLMMQLPEQQHQPGS-SNAAVGANGSNIL---------
NLGFFS----------AGNSGGTSGSLQDARIAIQDQFN-LSGSGSG-------------
---SAEHGNNVMVASIGSHLG--RG--FPSLYSSS-PSAGMAQNSATALLMKAAQMGSTT
------SSTTHNNHNGPTTTSTLLRATGFSGATGSG---QLGTTGGRAAAGE------EG
AASHEAH-FHELIMNSLA-----------G-----G--------------------GFSG
-----TAG-FGGGV------------------------------------DDGKLSTRDF
LGVGR-----------------------------GAATMAPP--------------GLHM
GALDPAQ------Q----------------------------------------------
-M---K
>gi|140064565|gb|ABO82700.1|	   519 residues, 50 /line  Zinc finger, C2H2-type [Medicago truncatula]
------------------------------------------------------------
MVDLDN----------VSTASGEASISSSGNNN---------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------I-----------------------
--------------------------QSPIPK-PTKK-----------------------
--------------------------------------------------------KRNL
PGMPDPEAEVIALSPTTLLAT----NR---------------------------------
---------------------------FV-------------------------------
-------------------------CEICNKGFQRDQNLQLHRRGHNLPWKLRQRSSKE-
IRKRVYVCPE--------PTCVHHDPSRALGDLTGIKKHFCRKH-GEKKWKCEKCS--KK
YAVQSDWKAHSKV-CGSR-EYKCD-CGTVFSR--------------RDSFITHRAFCD-A
LAEENAKSQNQAVG--KANSESDSK---VLTGDSLPAVITTTAAA---------------
--AATTPQSNSGVSSALETQKLDLPENPP-----QIIEEPQVV-----VTTTA-------
-----------SALNASCSSSTSS----KSNGCAATSTGVFASLFASSTASASASLQ--P
QAPAFSDLIRSMGCT-------------------DPRPTD-FSAPPS-------------
----SEAISLCLSTSHGSSIFGTGGQECRQ----YVPTHQPPAMSATALLQKAAQMGAAA
------TNAS------------LLRGLGIVSSSASTSSGQQDSLHWGLGPMEPEGSSLVS
---------A----------------------------------GLGLGLPCDADSG---
--LKELML-GTPSM------------------------------------FGPKQTTLDF
LGLGMAAG-GSAGGGL-SALITSIGGG----------------------SGL--DVTAAA
ASFGNGEFSGKDIG----------------------------------------------
-RS--S
>gi|18407949|ref|NP_566877.1|	   446 residues, 50 /line  zinc finger (C2H2 type) family protein [Arabidopsis thaliana]
----------------------------------------MMM-----------------
PDDHHPLS-----FPSYVLHQEHIAPNPNPN-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------P-----------------------
--------------------------NPTSSN-SAKR-----------------------
--------------------------------------------------------KRNL
PGNPDPDAEVIALSPNSLMTT----NR---------------------------------
---------------------------FI-------------------------------
-------------------------CEVCNKGFKRDQNLQLHRRGHNLPWKLKQRTNKEQ
VKKKVYICPE--------KTCVHHDPARALGDLTGIKKHFSRKH-GEKKWKCDKCS--KK
YAVMSDWKAHSKI-CGTK-EYRCD-CGTLFSR--------------KDSFITHRAFCD-A
LAEESARFVSVPPAPAYLNNALDVE---VNHGNINQNHQQRQLNTTSSQLDQPGFNTN--
-------------RNNIAFLGQTLPTNVF-----ASSSSPSPR-----SASDSLQN----
-----L-----WHLQGQSS-------------------------------HQW--LL--N
ENNNNNNNILQRG----------------------ISKNQ-EEHEMK-------------
---NV------ISNGSLFSSEARNN-TNNY----NQNGGQIASMSATALLQKAAQMGSKR
------SSSS----------SSNSKTFGLMTSIFNNKQAEN----IKTKE----------
------------------------------------------------------------
--------------------------------------------------VDERGFTRDF
LGVGSQHR-SWPLLMV-NHNLPDS---------------------------------SPP
ASTDGTPTADMN------------------------------------------------
-----Q
>gi|9858780|gb|AAG01127.1|AF273333_12	   519 residues, 50 /line  BAC19.12 [Lycopersicon esculentum]
------------------------------------------M-----------------
PADPDNSS-----AMNDSTGSGEASVSSSGN-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------Q-----------------------
--------------------------VVPLKE-SAKK-----------------------
--------------------------------------------------------KRNL
PGMPDPDAEVIALSPTTLLAT----NR---------------------------------
---------------------------FV-------------------------------
-------------------------CEICSKGFQRDQNLQLHRRGHNLPWKLRQRSSNE-
VKKRVYVCPE--------SSCVHHDPSRALGDLTGIKKHFCRKH-GEKKWKCDKCS--KK
YAVQSDLKAHSKI-CGTR-EYKCD-CGTLFSR----------------------AFCD-A
LAQESAKTLPEKP--PSTNEEPKTQ---AVASSSPPPSPPAPPPATESQPPPPPPAAPKS
LMTPTVPPSTAVMSFASSVQNRELRENPV-----TNSAGAATK-----QVVEEAAV----
-----V-----ASLTGNCSSSCSN----G-----SSSSNVFGSLFASSTASGS--LP--S
QAPVFSDIFRAMA----------------------PEHTL-EMAPPS-------------
---STEPISLGLAMSHSSSIFRPAG-QERR----QYAPAPQPAMSATALLQKAAQMGAAA
------TSSS------------FLRGIGVMSSTSSSNGHQE----WSGRPSDANGASL-A
---------A----------------------------------GLGLGLPCDAGSG---
--LKELML-GTPSV------------------------------------FGPKHPTLDL
LGLGMAAS-VGPSPGL-SALLTSMGSN------------------------L--DMVTSA
GSFGSADFSGKDLG----------------------------------------------
-RN--S
>gi|30677977|ref|NP_178317.2|	   516 residues, 50 /line  ATIDD4 (ARABIDOPSIS THALIANA INDETERMINATE(ID)-DOMAIN 4); transcription factor [Arabidopsis thaliana]
-----------------------------------------MS-----------------
SSSYNTSV-----IPSSSSSAQPFFITSSGTGDN--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------DFNRKDTFMSMIQQ-----------------------
--------------------------PNSSAP-PPKK-----------------------
--------------------------------------------------------RRNQ
PGNPNPDAEVVALSPKTLMAT----NR---------------------------------
---------------------------FI-------------------------------
-------------------------CDVCNKGFQREQNLQLHRRGHNLPWKLKQKSTKE-
VKRKVYLCPE--------PTCVHHDPSRALGDLTGIKKHYYRKH-GEKKWKCEKCS--KR
YAVQSDWKAHSKT-CGTK-EYRCD-CGTIFSR--------------RDSYITHRAFCD-A
LIQETARNPTV---SFTSMTAASSG---VGSGGIYGRLGGGSALSHHHLSDHPNFGFNP-
-----------LVGYNLNIASSDNRRDFI-----PQSSNPNFL-----IQSASSQG----
-----M-----LNTTPNNN----------------------NQSFMNQHGLIQ--FD--P
---VDNINLKS------------------------SGTNN-SFFNLG-------------
---F-FQENTKNSETSLPSLYSTDVLVHHR----EENLNAGSNVSATALLQKATQMGSVT
------SNDP----------SALFRGLASSSNSSSVIANHF----GGGRIMENDNNGN-L
---------Q----------------------------------GLMNSLAAVNGGGGSG
GSIFDVQFGDNGNM------------------------------------SGSDKLTLDF
LGVGGMVR-NVNRGGG-GGGRGSARGG---------------------------VSLDGE
AKFPEQNYP---FG----------------------------------------------
-R---G
>gi|55418546|gb|AAV51393.1|	   544 residues, 50 /line  INDETERMINATE-related protein 1 [Zea mays]
----------------------------------------MAA-----------------
ASSAHLFG-----LGDGQMQM----------QPQ--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------QQQAPPPPL----V-----------------------
--------------------------NNPAAP-PPKK-----------------------
--------------------------------------------------------KRNQ
PA--DPDAEVIALSPKTLMAT----NR---------------------------------
---------------------------FV-------------------------------
-------------------------CEVCNKGFQRDENLQLHRRGHNLPWKLKQKNPKET
RLRRVYLCPE--------PTCVHHDPSRALGDLTGIKKHYCRKH-GEKKWKCDKCN--KR
YAVQSDWKAHSKT-CGTR-EYRCD-CGTLFSR--------------RDSFITHRAFCD-A
LAQESARVPPM---GAGMYGTGGMA---LGLSGM-ATSQLQSFQDQTHSSATTAISNNP-
-----------TAQFEHLMQSSTGSPVFRGAQPTSSSSSPFYL-----GGAEDGHQ----
-----SLSGHTSLLHGNKQAYHGLML-LPEQQHQAGSNGLLNLGFFSGGSSGQDARL--V
FPDQFNGAVGGNVRG-------------------DGSEHGNSGANTE-------------
---SAAIFSGNLMGNHQMASSAGFSSSLYN----SSETAAPAQMSATALLQKAAQMGATT
------SSGNV---------NSLLRGLGSSA--GGTLNGRPAGASAGFMAGESSSARSTS
QAENESQ-FR----------------------------------DLMNTLAA-SGSGAAG
TA----FSGGFPGM------------------------------------DDSKLSTRDF
LGVGGSV---VRSMGG-AAGLPLRHGG----------------------AA-----GIGM
GSL--------DTE----------------------------------------------
-M---K
>gi|125570893|gb|EAZ12408.1|	   424 residues, 50 /line  hypothetical protein OsJ_002233 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------MAT----NR---------------------------------
---------------------------FV-------------------------------
-------------------------CEICGKGFQRDQNLQLHRRGHNLPWKLKQRGSKEA
VRKKVYICPE--------ASCVHHDPSRALGDLTGIKKHFFRKH-GEKKWKCDKCS--KK
YAVHSDWKAHSKI-CGTR-EYKCD-CGTIFSR--------------RDSFITHRAFCD-A
LTEESAKAIGGIPAA--MAAPGHHHHHHHHHHQLLFSPPPVMAH------HQEL------
----AALQEQQ--QQQHHQDVMQSPHQHQQQQ----------------------------
------------------------------------------------------------
------------QQRQQLVQQNC-------------------------------------
----------GYAREA-----GDGAVADDD----ALRPPPPAAAAALQRQRRRHGAELGH
------VRATDDAAAARRRR-----RRAPVRHGAAAESRE------------------KL
--------AHSFAGAGTGAPG---GEKGPHGDGGGGGGNGLIPAGMMGHLARTASHG---
--RSGEDV-AGAGG------------------------------------GGGDGMTRDF
LGLRAFSHRDILLAGFDSSCMGHV------NAAAGMAGYEPPPPHHGQPQHQ--HQQQQQ
QQQGGSNEPWHGMG----------------------------------------------
-SH--S
>gi|42475462|dbj|BAD10885.1|	   522 residues, 50 /line  zinc finger protein [Malus x domestica]
---------------------------------------MSIITGSAATGSFSSGNTGGE
EVQQQQQE----LLNHHANFHGSNSLLPTTP-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------NINSNGISTTQ--------------------------
--------------------------VQKQPP-PAKK-----------------------
--------------------------------------------------------KRNL
PGTPDPTAEVIALSPKTLMAT----NR---------------------------------
---------------------------FV-------------------------------
-------------------------CEICKKGFQRDQNLQLHRRGHNLPWKLKQRTSTE-
IIKRVYICPE--------SSCVHHDPSRALGDLTGIKKHFFRKH-GEKTWKCDKCS--KK
YAVQSDWKAHLKT-CGTR-EYKCD-CGTIFSR--------------RDSFITHRAFCD-A
IAEENNRNQGVVPMS--NNIMGAPNQGQLSNSELIIPASPPMNNKITDNPSSAR------
----SDTTTSD--QFHHNFDAKNAPLTLEPQQPFPMPTKP--------------------
------------------------------------------------------------
-----------VNMLPRTLSNNT-------------------------------------
----------SSSTSPSSLLFGLNHGGHDQ----SLIPNSSGHLSATQLLQKAAQMGATM
------SGGPNPNPSGTTIT-----SMAPSTYGTATGGYN------------------MN
PFMQQRD-PNNILQLETSPQFFGANYAQMGMFSGMLFDHAQNNGLLKNMEHENNGTS---
--NKIGFR-GASNV------------------------------------GNGDTLTVDF
LGLGGS------------------------------GNNNRPENFHDLQKQQ--HGQQDQ
LGFGGIDDHDDHLR---------------------------------------------M
QRF--G


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.