Fandom

Proteins Wiki

At2g01940.1

47,922pages on
this wiki
Add New Page
Talk0 Share

In the plant Arabidopsis thaliana, At2g01940.1 is a gene model for the locus At2g01940.[1]

Also known as SGR5, and ATIDD15, this gene model is classified by TAIR as "SGR5 (SHOOT GRAVITROPISM 5); nucleic acid binding / transcription factor/ zinc ion binding". It is located on chr2, region 432651-434916 FORWARD.

Physiological functionEdit

At2g01940.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g01940.1/Expression

Subcellular localizationEdit

At2g01940.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g01940.1 has 445 amino-acid residues and a molecular weight Mw = 50.157 kDa.

The protein is relatively basic; at the physiological pH 7.4, its net charge is 17.33, or 0.039 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g01940.1/Knockout

Protein interactionsEdit

At2g01940.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g01940.1 has 2 recognized domains:

  • Domain_0073_0095 zf-C2H2 domain (PF00096, IPR007087) Description: Zinc finger, C2H2-type;Molecular Function: nucleic acid binding (GO:0003676), Cellular Component: nucleus (GO:0005634), Molecular Function: zinc ion binding (GO:0008270)
  • Domain_0151_0173 zf-C2H2 domain (PF00096, IPR007087) Description: Zinc finger, C2H2-type;Molecular Function: nucleic acid binding (GO:0003676), Cellular Component: nucleus (GO:0005634), Molecular Function: zinc ion binding (GO:0008270)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g01940.1
MRTDQVMLSN KNTNTCCVVS SSSSDPFLSS SENGVTTTNT STQKRKRRPA GTPDPDAEVV SLSPRTLLES DRYICEICNQ GFQRDQNLQM HRRRHKVPWK LLKRDNNIEV KKRVYVCPEP TCLHHNPCHA LGDLVGIKKH FRRKHSNHKQ WVCERCSKGY AVQSDYKAHL KTCGTRGHSC DCGRVFSRVE SFIEHQDNCS ARRVHREPPR PPQTAVTVPA CSSRTASTVS TPSSETNYGG TVAVTTPQPL EGRPIHQRIS SSILTNSSNN LNLELQLLPL SSNQNPNQEN QQQKVKEPSH HHNHNHDTTN LNLSIAPSSS YQHYNNFDRI KEIMASEQIM KIAMKEKAYA EEAKREAKRQ REIAENEFAN AKKIRQKAQA ELERAKFLKE QSMKKISSTI MQVTCQTCKG QFQAVAVPAA TADETSLVVS YMSSANTDGE LENGF
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.