FANDOM


>gi|18379315|ref|NP_565278.1|	 unknown protein [Arabidopsis thaliana]
------------MVVVL--GLQSLKWYT-HGRIMETKKKRHLMRIVQATERE-----DSF
QIDR-DKAREALK---QLDQQIESQADEKPRIINKTSSDVVRTNNDPI----MFEEPPEI
SGSFLTSSAFVLLALTLFYNILFITVIKPSMDGPE-------------------------
-----------------SVPEENS----VAMSDSDIVKFPLSSLPENTFK----------
---------------Q
>gi|115472871|ref|NP_001060034.1|	 Os07g0568900 [Oryza sativa (japonica cultivar-group)]
----MHLRFVPFPAIAV--GGASLRFLADNTRAVGGSGRRRCSDVVAFSSSEKGPGPGSG
EERE-PRAEEALRRLAELDSQLEGLSEPRERPPAPPLPPDPYMDRDMITGRGSKDELPEF
SPTYVTFSTLALVILTIFTNVVFNLYIKPSVDGVDQP-----------------------
-------------------------VRIERVPMVNPADQQFK------------------
----------------
>gi|125558854|gb|EAZ04390.1|	 hypothetical protein OsI_025622 [Oryza sativa (indica cultivar-group)]
----MHLRFVPFPAIAV--GGASLRFLADNTRAVGGSGRRRCSDVVAFSSSEKGPGPGSG
EERE-PRAEEALRRLAELDSQLEGLSEPRERPPAPPLPPDPYMDRDMITGRGSKDELPEF
SPTYVTFSTLALVILTIFTNVVFNLYIKPSVDGVDQPHPYVLNESFCWLWEFNNSRTFCT
CLYGLFDAISWKVMAVWDLQDRNSEVPLYAVNILGVINAELECAVDNGRVRGEKRSSTEL
LWCGSGPELYDLLLCR
>gi|125600775|gb|EAZ40351.1|	 hypothetical protein OsJ_023834 [Oryza sativa (japonica cultivar-group)]
----MHLRFVPFPAIAV--GGASLRFLADNTRAVGGSGRRRCSDVVAFSSSEKGPGPGSG
EERE-PRAEEALRRLAELDSQLEGLSEPRERPPAPPLPPDPYMDRDMITGRGSKDELPEF
SPTYVTFSTLALVILTIFTNVVFNLYIKPSVDGVDQP-----------------------
--------------------DRNSEVPLYAVNILGVINAELECAVDNGRVRGEKRSSTEL
LWCGSGPELYDLLLCR
>gi|21617897|gb|AAM66947.1|	 unknown [Arabidopsis thaliana]
---------------------------------METKKKRHLMRIVQATERE-----DSF
QIDR-DKAREALK---QLDQQIESQADEKPRIINKTSSDVVRTNNDPI----MFEEPPEI
SGSFLTSSAFVLLALTLFYNILFITVIKPSMDGPE-------------------------
-----------------SVPEENS----VAMSDSDIVKFPLSSLPENTFK----------
---------------Q
>gi|147784772|emb|CAN70700.1|	 hypothetical protein [Vitis vinifera]
MLLLQSLSPSPLPPLSLSSGQPISQFLSHCVGNHPTWSRRRRSSASSVSTVHAVDKDSQQ
FEVDPDKAREALQ---KLDQQLQSLSQKQASNQN-------------LAGDQMREEPVEL
SGSFLAYSALALVVFTIFYNVLFLTVIQPSIDGQ--------------------------
------------------------------------------------------------
----------------


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.