&&&&&&&&&&&&&&&&&&&& BEGIN /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&& Successfully read 2 file paths from WYRM_file_paths.txt generic_input /usr/local/www/html/proteins/workspace/ generic_output /usr/local/www/html/proteins/htdocs/results/ ====================================================== Sequence file type = 3 Sequence type = 3 Got here 1 Got here 2 Got here 3 Sequence 1 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Sequence 2 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g01860_1w3b_A.pir.txt ====================================================== Assigned types to 486 residues in Sequence 2-01860, 11 remain unknown Assigned types to 370 residues in Sequence 1w3b_A, 127 remain unknown ====================================================== Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat ====================================================== Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 157 All residues are positively and negatively charged Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 193 All residues are positively and negatively charged Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 230 All residues are positively and negatively charged Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 251 All residues are positively and negatively charged Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 252 All residues are positively and negatively charged Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 253 All residues are positively and negatively charged Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 254 All residues are positively and negatively charged Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 255 All residues are positively and negatively charged Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 264 All residues are positively and negatively charged Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 442 All residues are positively and negatively charged Error in function WYRM_analyze_conservation_in_sequence_alignment() Path index 478 All residues are positively and negatively charged Translated sequence file At2g01860_1w3b_A.pir.txt into sequence alignment. ====================================================== >1W3B.pdb Made from 5568 ATOM records in 1W3B.pdb GPMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLD RSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGR LEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDP NFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQ GLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQ QQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDGPMELAHREYQA GDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALV AAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAI ETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNV LKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRR AIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSYRKAL EVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNT LKEMQD ====================================================== Best alignment: 1W3B.pdb 104 YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEE 153 Y+ + + D V A + L+ DL + D +++K +L E 2-01860 294 YVKMILEIAKNPDKYHLVVALLEELKKREDLKLSQQDCTSIMKICVKLGE 343 ====================================================== Highlighted IDENTICAL residue ALA 125 index1 113 path 312 %Seq 100.00 Highlighted IDENTICAL residue GLN 134 index1 122 path 321 %Seq 100.00 Highlighted IDENTICAL residue ALA 135 index1 123 path 322 %Seq 100.00 Highlighted IDENTICAL residue ASP 145 index1 133 path 332 %Seq 50.00 Highlighted IDENTICAL residue LEU 146 index1 134 path 333 %Seq 50.00 Highlighted IDENTICAL residue GLU 164 index1 152 path 351 %Seq 100.00 Highlighted 6 residues for visualization Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g01860_1w3b_A.pir.txt.1W3B.pdb.conservation.pml =============================================================================== The program /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g01860_1w3b_A.pir.txt PIR amino_acid 1W3B.pdb _ 100.0 BLOSUM62.dat completed successfully. @@@@@@@@@@@@@@@@@@@@ END /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@
Advertisement
47,920
pages
At2g01860.1/Structure
Advertisement