FANDOM


>gi|42568870|ref|NP_178295.2|	   486 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
-----MILHCPVSLSLSFHL--------NLR--TSRIG----------------------
-------NIGVTRVNASQRNHSKK------------------------------------
------------------------------------LTKNLRNPRRTKLPPDFGVNLFLR
KPKIEPLVIDDDDEQVQESVNDDDDAVVWEPEEIEAISSLFQKR--IPQKPDKPSRVRPL
PLP---------QPHKL-RPLGLPTPKKNIIRSPAL----------SSV-----------
-SK-QV------------------------------------------------------
----------------YKDPSFLIGLAREIKSLPSSDADVSLVLN--------KWV--SF
L-RKGSLSTTIRELGHM--GL-----PERALQT-YHWAEKH--SHLVPDNRILASTIQV-
LAKHHE---LKL--L------------KFD--NSLASKNVIEAMIKGCIEGGWL----NL
ARKLILIS-K-SN-N-RILDSSVYVKMILEIAKNPDKYHLVVALLEELKKREDLKLSQQD
CTSIMKICVKLGEFE--LVE-SLFDWF-KASN-REPSVVMYTTMIHSRYSEQKYREAMSV
VWEMEE-SNCLLDLPAYRVVIKLFVA-LDDLGRAMRYYS-KLKEAGFSPTYDIYRDMISV
YTASGRLTKCKEICKEVEDA---GL-RLDKDTSFRLLQL---------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----EKQTMSLLH
>gi|21553611|gb|AAM62704.1|	   463 residues, 50 /line  unknown [Arabidopsis thaliana]
-------------------M--------GKVPSSFRSIPAN---------LLVR-----K
TTPSPPAPP---RDFRNRTAVGGDSAKLP-------------------------------
----------------HNTQAPRE------------------------------------
-------------------------------------PSLRNPF--KSPNLS--------
----------------------------------------------DAKSLFNSIA-ATS
RIPLDL------------------------------------------------------
----------------KFHNSVLQSYASIAV--VDDTVKFFQHIMKS------QPN--FR
P-GRSTFLILLSHACRAPDSS-----ISNVHRV-LNLMVNN--G-LEPDQVTTDIAVRS-
LCETGR---VDE--AKDLMK--EL---TEK--HSPPDTYTYNFLLKHLCKCKDL----HV
VYEFVDEM-R-DDFD-VKPDLVSFTILI--------------------------------
-----DNVCNSKNLR--EAM-YLVSKL-GNAG-FKPDCFLYNTIMKGFCTLSKGSEAVGV
YKKMKE-EGVEPDQITYNTLIFGLSK-AGRVEEARMYLK-TMVDAGYEPDTATYTSLMNG
MCRKGESLGALSLLEEMEAR---GC-APNDCTYNTLLHGL--------------------
----------CKARLMDKGM-ELYEMMKS-SG--VKLESNGYATLVRSLVKSGKVAEAYE
VFDYAV---DS-KSLSD-------------------------------------------
---ASAYSTLETTLKWLKKAKE--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------QGLVP
>gi|21617993|gb|AAM67043.1|	   394 residues, 50 /line  unknown [Arabidopsis thaliana]
---MSSLSRFLLRGNFSFST--------PTN-----------------------------
------------------------------------------------------------
-------------------------RRFFSAVTAAAATPSPP------------------
KPSLITLVNDERDPK---------------------------------------------
----------------------------------------------FITEKFKKACQAEW
FRK-NI------------------------------------------------------
----------------AVYERTVRRLAAAKK--FEWVEEILEEQN--------KYP--NM
S-KEGFVARIINLYGRV--GM-----FENAQKV-FDEMPER--N-CKRT-----------
-------------------------------------VLSFNALLNACVNSKKF----DL
VEGIFEEL-PGKL-S-IEPDVASYNTLI--------------------------------
-----KGLCGKGSFT--EAV-ALIDEI-ENKG-LKPDHITFNILLHESYTKGKFEEGEQI
WARMVE-KNVKRDIRSYNARLLGLAM-ENKSEEMVSLFD-KLKGNELKPDVFTFTAMIKG
FVSEGKLDEAITWYKEIEKN---GC-RPLKFVFNSLLPAI--------------------
----------CKAGDLESAY-ELCKEIFA-KR--LLVDEAVLQEVVDALVKGSKQDEAEE
IVE---------------------------------------------------------
------------------------------------------------------------
-----------------------------------------LAKTNDYLQCKLR-LFPK-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------E
>gi|30689969|ref|NP_197945.2|	   574 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
----MEDVNQEKKKVPPMSE--------PERSTP--------------------------
--------------------------------------------IKTTGGQYRFCKSCVE
GSSCRT------------------------------------------------------
--------------------------------VRSRTKLMNVLI--ERGRPH--------
----------------------------------------------EAQTVFKTLA-ETG
HRP-SL------------------------------------------------------
----------------ISYTTLLAAMTVQKQ--YGSISSIVSEVE--------QSG--TK
L-DSIFFNAVINAFSES--GN-----MEDAVQA-LLKMKEL--G-LNPTTSTYNTLIKG-
YGIAGK---PER--SSELLD--LMLEEGNV--DVGPNIRTFNVLVQAWCKKKKV----EE
AWEVVKKM-E-EC-G-VRPDTVTYNTIA--------------------------------
-----TCYVQKGETV--RAESEVVEKMVMKEK-AKPNGRTCGIVVGGYCREGRVRDGLRF
VRRMKE-MRVEANLVVFNSLINGFVE-VMDRDGIDEVLT-LMKECNVKADVITYSTVMNA
WSSAGYMEKAAQVFKEMVKA---GV-KPDAHAYSILAKGY--------------------
----------VRAKEPKKAE-ELLETLIV-ES---RPNVVIFTTVISGWCSNGSMDDAMR
VFNKMC---KF-GVSPN-------------------------------------------
---IKTFETLMWGYLEVKQPWKAEEVLQM------MRGCGVKPEN---------------
-----------------STFLLLAEAWRVAGLTDESNKAINALKCKDIEIAKLEKLYQKQ
SSGSSFNLLQIPVGK---------------------------------------------
------------------------------------------------------------
-----RELPTAKAMNLSACKLGARVPII------------CQKQSQAQFGI-----SGQF
V----HSCTVFLS
>gi|30697337|ref|NP_849849.1|	   544 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
---MASALRRLVEQQQWRYL--------VSQSTRSPKLIHGFFS----------------
-------FSSKTNPNPNKQQ-----------------QILIDY-ISKSLQSNDTWETLST
K--FSSI-----------------------------------------------------
-----------------------------DLSDSLIETILLRFK--NPETAK--------
----------------------------------------------QALSFFHWSSHTRN
LRH-GIKSYALTIHILVKARLLIDARALIESSLLNSPPDSDLVDSLLDTYE-ISS-----
-------------STPLVFDLLVQCYAKIRY--LELGFDVFKRLC--------DCG--FT
L-SVITLNTLIHYSSKS--KI-----DDLVWRI-YECAIDK--R-IYPNEITIRIMIQV-
LCKEGR---LKE--VVDLLD--RI---CGK--RCLPSVIVNTSLVFRVLEEMRI----EE
SMSLLKRL-L-MK-N-MVVDTIGYSIVV--------------------------------
-----YAKAKEGDLV--SAR-KVFDEM-LQRG-FSANSFVYTVFVRVCCEKGDVKEAERL
LSEMEE-SGVSPYDETFNCLIGGFAR-FGWEEKGLEYCE-VMVTRGLMPSCSAFNEMVKS
VSKIENVNRANEILTKSIDK---GF-VPDEHTYSHLIRGF--------------------
----------IEGNDIDQAL-KLFYEMEY-RK--MSPGFEVFRSLIVGLCTCGKVEAGEK
YLKIMK---KR-LIEPN-------------------------------------------
---ADIYDALIKAFQKIGDKTNADRVYNE------MISV---------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------R
>gi|3395430|gb|AAC28762.1|	   453 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------MARSSSWH----RM--------SNFMRKYRKIPHSSFKTK--------------
------------------------------------------------------------
--------------------------------------------WNENLKQKYAMEELRS
----------------------------------------NLLT--DSENAS--------
----------------------------------------------VMRTLLSSFQ-LHN
CEP-TP------------------------------------------------------
----------------QAYRFVIKTLAKSSQ--LENISSVLYHLEV-------SEK--FD
T-PESIFRDVIAAYGFS--GR-----IEEAIEV-FFKIPNF--R-CVPSAYTLNALLLV-
LVRKRQ--SLEL--VPEILV--KA---CRM--GVRLEESTFGILIDALCRIGEV----DC
ATELVRYM-S-QD-S-VIVDPRLYSRLL--------------------------------
-----SSVCKHKDSSCFDVI-GYLEDL-RKTR-FSPGLRDYTVVMRFLVEGGRGKEVVSV
LNQMKC-DRVEPDLVCYTIVLQGVIA-DEDYPKADKLFD-ELLLLGLAPDVYTYNVYING
LCKQNDIEGALKMMSSMNKL---GS-EPNVVTYNILIKAL--------------------
----------VKAGDLSRAK-TLWKEMET-NG--VNRNSHTFDIMISAYIEVDEVVCAHG
LLEEAF---NM-NVFVK-------------------------------------------
---SSRIEEVISRLCEKGLMDQAVELLAH------LV-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------
>gi|473874|gb|AAA17740.1|	   435 residues, 50 /line  a membrane-associated salt-inducible protein
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------MLINGFIYL--KD-----WANAFAI-FEDVIRD--G-LKPDVVLYNNIIRA-
FCGMGN---MDR--ALRIVE--QM---KKE--RHRPTSRTFMPIIHAFAKAGAI----RK
ALDVFDMM-R-RS-G-CIPTVQTYNALI--------------------------------
-----LGLVEKRQMD--KAV-EVVDEM-LLAG-IRPNERTYTTIMDGYASLGDTGKAFEY
FSRIKD-EGLELDVYTYEALLKACCK-SGRIESALAVTK-EMNAKNIPRNTFVYNILIDG
WARRSDVWEAADLMQQMRQE---GV-QPDIHTYTSFVNAC--------------------
----------CKAGDMQKAM-NTIQEMKR-VG--LNPMLKPI-PLSYTVGHASLPEKALK
CFEEMK---KS-GLKPD-------------------------------------------
---KAVYHCLMTSLLSRATVAEDYIITGIHRVCEEMVESGLTVDMGTAVHWSRCLRKIER
TGGDITEALQKTFPPDWNSHRNLNAASYDTGNN---------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------EGLNDRVTTMVLCMR------------LTVTATVTMIQMP-------
-----PRCNQKVA
>gi|53749325|gb|AAU90184.1|	   395 residues, 50 /line  unkonwn protein [Oryza sativa (japonica cultivar-group)]
---MESV----LARLPSSLR--------PREP----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------LLCRVISAYGRARL--PAAARRAFAH-P--------AFP--AP
R-TARALNTLLHALLAC--R-------APLPEL-LSECRGS--G-IHPDACTYNILMRAA
VADSGS---VDN--ACLLFD--EM---LQR--GIAPTVVTFGTLVTAFCEAGRL----EE
AFKVKEVM-SLQY-N-IRPNAHVYASLM--------------------------------
-----KALCEKGKVD--DAH-RLKEEM-VSNSEPLVDSGAYATLARALFRLGKKGEVVSL
LEEMKE-KGIKVGREVHNSMIAGFCEDEGDLDAAFAALD-DMQKGGCKPDSVSYNTLVGG
LCKMGRWRDASELVEDMPRR---GC-RPDVVTYRRLFDGI--------------------
----------CDAGGFSEAR-RVFNEMVF-KG--FAPSKDGVRKFVAWIEREGDAASLES
VLCQLA---SV-NALES-------------------------------------------
---SEWEKAM-SGVLHDPAEQKIVKL----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------LDNLSLA
>gi|54695176|dbj|BAD67153.1|	   563 residues, 50 /line  PPR566-6 [Physcomitrella patens]
TLSISHLFSR--------------------------PLAVSQLQCRCCSRD--------R
APVRGHLRKGKAITVEMLRALPAAAAHSRVQEPLFAGFDFEERAFREFKQTVSCCNC---
RTNFGRCGSSLSVVWVGMAERDVEATRFSSRGLGFWVRRGLWRRRCFAESDSFGELEDVS
PVSLEGVSLAELLAQVGASEGRDESGLV-QIESNPHPSLLRRYR--ELDKPF--ERGRSL
PIP---------MPHKLNRPIPMPPSRRSFLPHGPV----------PSTAVRRDVGPSLS
TKS-DT------------------------------------------------------
----------------LSYPRLLSKILVVSD--D--EVRMVLELW--------KGR--SR
C-KRGAIANLILQLGRW--DS-----AGKALQL-FAWVREQ--GRLWPDDSILLAIIRV-
ALESRK---LTL--ANKFMT--IY-----G--PLSPESAL--VAASVYVEQGFI----YD
AWRILKSL-E-QR-G-VTANSELYAKMIVKAGEA-----GARDIVEDIVA--GLCFSLED
CTRVMTVCSRLGLDE--EVE-ALYLRF-LEQG-LKPNIVMFTALMQARARAGNVRQALAL
FWEMEE-QGVKPDLVACRVMIRLCEK-VGDLNKAVKVYN-NMRMAGFVPTSDVYNVMIRL
YCKEGRLAKVKEVMREMEMW---GC-SPTSDTSKNLLFA---------------------
-----------------------------------------------GY-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------KPS
>gi|7529747|emb|CAB86932.1|	   526 residues, 50 /line  putative protein [Arabidopsis thaliana]
------------------------------------------------------------
---------------------MEVFKDAADETDQKRWRGLMLE-IESTGSAVPVLRQ---
YKTDGD------------------------------------------------------
---------------------------Q-GLPRDLVLGTLVRFK--QLKKWN--------
----------------------------------------------LVSEILEWLRYQNW
WNF-SE------------------------------------------------------
----------------IDFLMLITAYGKLGN--FNGAERVLSVLS--------KMG--ST
P-NVISYTALMESYGRG--GK-----CNNAEAI-FRRMQSS--G-PEPSAITYQIILKT-
FVEGDK---FKE--AEEVFE--TLLDEKKS--PLKPDQKMYHMMIYMYKKAGNY----EK
ARKVFSSM-V-GK-G-VPQSTVTYNSLM--------------------------------
-----SFET---SYK--EVS-KIYDQM-QRSD-IQPDVVSYALLIKAYGRARREEEALSV
FEEMLD-AGVRPTHKAYNILLDAFAI-SGMVEQAKTVFK-SMRRDRIFPDLWSYTTMLSA
YVNASDMEGAEKFFKRIKVD---GF-EPNIVTYGTLIKGY--------------------
----------AKANDVEKMM-EVYEKMRL-SG--IKANQTILTTIMDASGRCKNFGSALG
WYKEME---SC-GVPPD-------------------------------------------
---QKAKNVLLSLASTQDELEEAKELTGI-----RNETATIIARV---------------
-----------------YGSDDDEEGV---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------EDISSESSDDEDEGD------------DDDDDARETVLYDKPQEGSL
GYGSLQTEELVGL
>gi|92868558|gb|ABE78562.1|	   553 residues, 50 /line  Pentatricopeptide repeat [Medicago truncatula]
---MCSLISKSHCHLGLGQL--------SLQPLQTRKLEYGIVNVKMSGRL--------K
VMCKGMLTP---RKFMQRKRKMVVFKDAADEAEQKNWWRLMKL-IDETGSAVSVLNS---
EKMK-N------------------------------------------------------
---------------------------Q-TIPKALVVGTLMRFK--QLKKWN--------
----------------------------------------------LVAEILEWLRAQNW
WDF-GK------------------------------------------------------
----------------MDFFMLITAYGKLGD--FNGAEKVLGLMN--------KNG--YA
P-NVVSQTALMEAYGKG--GR-----YNNAEAI-FRRMQTF--G-PEPSAFTYQIILKT-
FVQGNK---FKE--AEEVFD--KLLNDEKS--PLRPDQKMFNMMIYMYKKSGSH----EK
ARQTFALM-A-ER-G-IKKATVTYNSLM--------------------------------
-----SFET---NYK--EVS-NIYDQM-QRAD-LRPDVVSYALLINAYGKARREEEALAV
FEEMLD-AGVRPTRKAYNILLDAFSI-SGMVEQARIVFK-SMRRDKYMPDLCSYTTMLSA
YVNAPDMEGAEKFFKRLIQD---GF-EPNVVTYGTLIKGY--------------------
----------AKANDIEKVM-EKYEEMLG-RG--IKANQTILTTIMDAHGKNGDFDSAVN
WFKEMA---LN-GLLPD-------------------------------------------
---QKAKNILLSLAKTEEDIKEANELVL------HSIEINNLPKV---------------
-----------------NDHEEDDDDD---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------DEDNY-----------------------EYFDTQDAM----------
---------AYDE
>gi|8493579|gb|AAF75802.1|AC011000_5	   528 residues, 50 /line  Contains a RepB PF|01051 protein domain and multiple PPR PF|01535 repeats.  EST gb|AA728420 comes from this gene. [Arabidopsis thaliana]
--------------------------------MLAKIS---SSAKRFVHRSLVV-----R
GNAATFPLS---FSFCRRRAFSG---------KTSYDYREVLR-TGLSDIELDDAIGLFG
VMAQSR------------------------------------------------------
---------------------------P-FPSIIEFSKLLSAIA--KMNKFD--------
----------------------------------------------LVISFGEKME-ILG
ISH-NL------------------------------------------------------
----------------YTYNILINCFCRCSR--LSLALALLGKMM--------KLG--YE
P-DIVTLNSLLNGFCHG--NR-----ISDAVAL-VDQMVEM--G-YKPDTVTFTTLIHG-
LFLHNK---ASE--AVALID--RM---VQR--GCQPDLVTYGAVVNGLCKRGDT----DL
ALNLLNKM-E-AA-K-IEANVVIYSTVI--------------------------------
-----DSLCKYRHED--DAL-NLFTEM-ENKG-VRPNVITYSSLISCLCNYGRWSDASRL
LSDMIE-RKINPNLVTFSALIDAFVK-KGKLVKAEKLYE-EMIKRSIDPNIFTYSSLING
FCMLDRLGEAKQMLELMIRK---DC-LPNVVTYNTLINGF--------------------
----------CKAKRVDKGM-ELFREMSQ-RG--LVGNTVTYTTLIHGFFQARDCDNAQM
VFKQMV---SV-GVHPN-------------------------------------------
---ILTYNILLDGLCKNGKLAKAMVVFEY------LQRSTMEPDI---------------
-----------------YTYNIMIEGM---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------CKAGKWKMGGI
Y----FVASALKE
>gi|92876910|gb|ABE84187.1|	   501 residues, 50 /line  Pentatricopeptide repeat [Medicago truncatula]
---MRSIYRLV---------------------VRDRFG---ICTMALVSRTLFS-----S
LATYHAAEA---RDFWHKEQTQD---------LTRSVDILTTK-IGKGNSEDDILQSLIS
DEGVNG------------------------------------------------------
---------------------------I-HLSENLINRLLFRY----KDDWK--------
----------------------------------------------SALAIFRWAGSHSN
FKH-SQ------------------------------------------------------
----------------QSYDMMVDILGRMKA--MDKMREILEEMR--------QES--LI
--TLNTIAKVMRRFVGA--RQ-----WKDAVRI-FDDLQFL--G-LEKNTESMNVLLDT-
LCKEKF---VEQ--AREIYL--EL---K-H--YIAPNAHTFNILIHGWCNIRRV----EE
AHWTIQEM-K-GY-G-CRPCVISYSTII--------------------------------
-----QCYCQEQNFD--RVY-DLLDEM-QAQN-CSPNVVTYTTIMCALAKAEKFEEALQV
VERMNA-VGCRPDTLFFNSLIYTLGR-AGRIDDATHVFKVAMPKASVAPNTSTYNSMISM
FCYYAQEERAFGILKEMEKS---GLCKPDIQTYHPLIKSC--------------------
----------FKMREIDTWLNDILNDMVNKYH--IGLDLSTYTLLIHGLYRADRCKWAFD
LFEEMA---DQ-DIVPR-------------------------------------------
---YKTCRLLLDEVKQKNMHLAVVKIEVL------MKK----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------L
>gi|110740599|dbj|BAE98404.1|	   546 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------NDWQRSL--------------ALLDWVHEEAK
YTP-SVFAYNVVLRNVLRA---------------K---QFDIAHGLFDEMR-QRA-----
-----------LAPDRYTYSTLITSFGKEGM--FDSALSWLQKMEQ--------DR--VS
G-DLVLYSNLIELSRRL--CD-----YSKAISI-FSRLKRS--G-ITPDLVAYNSMINV-
YGKAKL---FRE--ARLLIK--EM---NEA--GVLPNTVSYSTLLSVYVENHKF----LE
ALSVFAEM-K-EV-N-CALDLTTCNIMI--------------------------------
-----DVYGQLDMVK--EAD-RLFWSL-RKMD-IEPNVVSYNTILRVYGEAELFGEAIHL
FRLMQR-KDIEQNVVTYNTMIKIYGK-TMEHEKATNLVQ-EMQSRGIEPNAITYSTIISI
WGKAGKLDRAATLFQKLRSS---GV-EIDQVLYQTMIVAY--------------------
----------ERVGLMGHAK-RLLHELKL-------PDNIPRETAITILAKAGRTEEATW
VFRQAF---ES-GEVKD-------------------------------------------
---ISVFGCMINLYSRNQRYVNVIEVFEK------MRTAGYFPDS---------------
-----------------NVIAMVLNAYGKQREFEKADTVYREMQEEG-CVFPDEVHFQML
SLYSSK-----------------------------------------KDF----------
--------------------EMVESLFQRLESDPNVNSKELHLVVAALYERADKLNDASR
VMNRM-------------------------------------------------------
--RERGILKPFPG
>gi|115436822|ref|NP_001043145.1|	   540 residues, 50 /line  Os01g0505500 [Oryza sativa (japonica cultivar-group)]
----------M-R----CLRRPATHLLCSAR---SAHAGNA-PRVLDEMPLPPLAPSRRT
-TTLVRAHHLLGAMRGPGFCTT-VGSESDVEPRFTV------------------------
---------------------------------VPGAAQE--------------------
---------------------------GLAPGVSEAAERVCRVV--SAQ---PEHRIAPV
L--D--ALGVTVSPQLV---AEVLKNLSNAGILAL--------------AFFRWAERQQG
FRY-SAEGFHNLIEALGKI---------------K---QFRLVWSLVEAMR-CRS-----
-----------CL-SKDTFKIIVRRYARARK--VKEAVETFEKMSS--------FG--LK
T-DLSDYNWLIDILSKS--KQ-----VKKAHAI-FKEMKRK--GRFIPDLKTYTVLMEG-
WGHEKD---LLM--LKAVYQ--EM---LDA--GIKPDVVAYGMLISAFCKSGKC----DE
AIKVFHEM-E-ES-G-CMPSPHVYCMLI--------------------------------
-----NGLGSMERLD--EAL-KYFQLS-KESG-FPMEVPTCNAVIGAYCRALEFHHAFKM
VDEMRK-SGIGPNTRTYDIILNHLIK-SEKIEEAYNLFQ-RMERDGCEPELNTYTMMVGM
FCSNERVDMALKVWKQMKEK---GV-LPCMHMFSALINGL--------------------
----------CFENRLEEAC-V--------------------------------------
------------------------------------------------------------
-------------------------YFQE------MLDKGIRPPG---------------
-----------------QLFSNLKEALVEGGRITLAQEVTQRLEMLR-RTP---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------MRG
>gi|115436834|ref|NP_001043148.1|	   541 residues, 50 /line  Os01g0506100 [Oryza sativa (japonica cultivar-group)]
-----------------MLARPGRLAASTLP---ND------SAAAAASTVLSILRGEDP
-AS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
L--P--AAGIDPCPAVF---QQLRPSLPTVPDSALP-------------ALARWAGEA--
----------TAVSLLTSR---------------G---LFAAAWRLL--LA-PSP-----
-----------TPPPLAAFAPLVRRYARLGR--APAALRAFQFLRRHPDRYMAGGD--IP
A-AASLLNMAVDALCKE--GH-----PRAAVEL-FERWRREEPD-SPPDERAYNILLHG-
WSRAGR---LDK--VGKLWA--EM---RLA--GVRPTVVTYGTLIEGLCVKRRP----DQ
AIALLDEM-R-EE-G-IEANLLTCNPIV--------------------------------
-----YALAQAGRFQ--DAH-KVLEKF-PLYG-VAPNISTFNSLVMGYCKHGDLAGASSV
LKVMTE-RGISPTTRTYNYFFMTFAK-NSDVESGMNFYS-KMIGNGYSPDQLTYVLLVKM
LSRANRLELVVQMIQEMRTH---GF-EPDLATSTMLIHLL--------------------
----------CRRHQFEEAC-A--------------------------------------
------------------------------------------------------------
-------------------------EFED------MFKRGIVPQY---------------
-----------------ITYQKLMRELKRLGLVHLIQKLTNLMRSVP-HSTKLPGSY---
-RDKEG-----------------------------------------DDSMEKRKLILQK
AQAVSDVLKECKDPKELGKLKEDEETDVEVAD------RLVANIRRSVYGGAS-------
------------------------------------------------------------
----TSSVMAPLS
>gi|115444491|ref|NP_001046025.1|	   397 residues, 50 /line  Os02g0170000 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------MALL-E-------
------------------------------------------------------AQ--CV
P-TEDTYALLLRAYCNA--GS-----LHRAEGV-ISEMREH--G-IPPNATVYNAYLDG-
LLKARC---TEK--AVEVYQ--RM---KRE--RCRANTETFTLMINVYGKAKQP----MS
SMKVFNEM-K-SI-G-CKPNICTYTALV--------------------------------
-----NAFAREGLCE--KAE-EVFEEM-QQAG-HEPDVYAYNALMEAYSRAGLPQGASEI
FSLMQH-MGCEPDRASYNILVDAYGR-AGLHEDAEAVFE-ELKQRGMSPTMKSHMLLLAA
HARSGNATRCEEVMAQLHKS---GL-TPDTFALNAMLNAY--------------------
----------ARAGRLDDME-RLFAAMER-RG---DADVGTYNVAVNAYGRAGYVGRMEA
AFAAVA---AR-GLAAD-------------------------------------------
---VVTWTARMGAYARRKEYGRCVGMVEE------MVDAGCYPDA---------------
-----------------GTARVLLAACSDERQVEQVTAIVRSMHKKP-KT----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------LFTI
>gi|115447143|ref|NP_001047351.1|	   580 residues, 50 /line  Os02g0601600 [Oryza sativa (japonica cultivar-group)]
---MCKKVNVV-K----YLGTKGALIKFDVK--IMGHVGDG-GGWLAGC-LTPLIEDRFL
-SSSTRYLASLGSKKVPFSHSP-LGGYRTGQPALGA------------------------
---------------------------------APDASYECR-----------MPPWRCE
GAATTSTLQ------IVYLIIRDVSNVNLTVEEEEAARLIKNSL--SKARKWSVQDLIQC
LGAD--CSGIRLTGNIV---DTLLFKFGDDWKSAL--------------GFFQWAQSRDD
YRH-TAYACNRMVDLLGKM---------------R-------------------------
------------------------------Q--IDQMWELLSDMHG--------RG--LV
T--VETVAKSIRRLAGA--RR-----WKDVVLL-FDKLEDM--G-LERNTETMNVLLDV-
LCKERK---IEV--AREVFA--VL---S-P--HIPPDAYTFNIFVHGWCSIRRI----DE
AMWTIEEM-K-RR-G-FPPSVITYTTVL--------------------------------
-----EAYCKQRNFR--RVY-EVLDSM-GSQG-CHPNVITYTMIMTSLAKCERFEEALSV
SHRMKS-SGCKPDTLFYNSLINLLGK-SGHLFEASQVFRVEMPMNGVSHNLATYNTMISI
FCYYGRDDDALNVLKEMEAQ---SC-KPDIQSYRPLLRLFL-------------------
----------SRRGQADTVR-HLLSELTS-K-----------------------------
----------H-NLGLD-------------------------------------------
---LDTYTLLIHGLCRVGDTVWAYQLFDE------MVSSEIAPRS---------------
-----------------KTCVMLLDEAQRTNMETYVERIGNYMSSF--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----GIS----V
>gi|115466680|ref|NP_001056939.1|	   511 residues, 50 /line  Os06g0172000 [Oryza sativa (japonica cultivar-group)]
-----------------MAAAPVASPFPALP---------------------------SS
-SSSTTIAASTAARRCHDALLP-PPAAAGREPARTR------------------------
---------------------------------GSSSSLAGA-----------AGERRRR
RGEEDGGEV------EAEAERRRKEEVNRKIASRKALSVILRRE--ATKAVL----DKRK
PGKG--TRRL--------------------------------------------------
------------------------------------------------------------
--------------LPRTVLEALHERITALR--WDSALKVFDLMRDQ-------VW--YR
P-YVGIYVKLITMLGKC--KQ-----PERAHEL-FQAMVDE--G-CAPNLESYTALVSA-
YSRSGR---FDR--AFSLLE--QM---KAT-PGCRPDVQTYSILIKSCLHAYDF----ER
VKYLMEDM-A-RA-G-IRPNVVTYNTLI--------------------------------
-----DAYGKAGRFA--EME-STLLEM-LTEN-CKPDVWTMNSTLRAFGGSGQIETMESC
YEKFQA-SGISPNIKTYNILLDSYGK-AKMYEKMGAVME-YMQKYYYSWTIVTYNVVIDA
FGRAGDLEQMEYIFRLMKSE---RI-KPNCVTLCSLVRAY--------------------
----------GRAGDVKKIK-T--------------------------------------
VLRIVE---NS-DITLD-------------------------------------------
---IVFFNCLVDAFGRVGCLAEMWDVLDI------MKLQRCKPDK---------------
-----------------VTCTTMIKWFLIKGIDDHRVQYLRDLKDGR-SKD---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------NI
>gi|115476328|ref|NP_001061760.1|	   554 residues, 50 /line  Os08g0402600 [Oryza sativa (japonica cultivar-group)]
--------ALL-S----LGRHADVRRAFGIL-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------ASAGARPDTFAWNKAVQACV--AA------------
----------------------------GDLGEAV--------------GMLRRMGRDGA
PPP-NAFSYNVVIAGMWRA---------------G---RGGDAVEVFDEMT-ERA-----
-----------VLPNHITYNTMIDGHIKGGD--LEAGFRLRDQMVC--------HG--LK
P-NAITYNVLLSGLCRA--GR-----MGETSAL-LDEMASQ--K-MVPDGFTYSILFDG-
LSRNGD---SKA--MLSLFG--KY---LKN--GVTIGDYTCSILLNGLCKDGKV----SI
AEEVLQSL-V-NA-G-LVPTRVIYNTLI--------------------------------
-----NGYCQTGELE--GAF-STFGQM-KSRH-IKPDHITYNALINGLCKAERITNAQDL
LMEMQD-NGVNPTVETFNTLIDAYGR-TGQLEKCFIVLS-EMQENGLKPNVVSYGSIVNA
FCKNGKIPEAVAILDDMFHK---DV-LPNAQVYNAIIDAY--------------------
----------VEHGPNDQAF-ILVEKMKS-NG--ISPSIVTYNLLIKGLCNQSQISEAEE
IINSLS---NH-RLIPD-------------------------------------------
---AVSYNTLISACCYRGNIDKALDLQQR------MHKYGIKSTV---------------
-----------------RTYHQLISGLGGAGRLNEMEYLYQKMMQNN-VVPSNAIHNIMV
EAYSKY-----------------------------------------G------------
-----------------------------------------------------NEIKAED
LRKEM-------------------------------------------------------
--LQKRNN-HDDT
>gi|115482764|ref|NP_001064975.1|	   506 residues, 50 /line  Os10g0499500 [Oryza sativa (japonica cultivar-group)]
---MARRVAAR-A----RAR-AGGVPRSEGT--IQDRARVG-S-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------GGAEDAL--------------DVFDELLRR-G
IGA-PIRSLNGALADVARD---------------N---PA-AAVSRFNRMA-RAGASM--
-----------VTPTVHTYGILIGCCCSAGR--LDLGFAALGHVVK--------KG--FR
V-EPIIFNPLLKGLCAD--KR-----TDDAMDIVLRGMTEL--S-CVPNVFSHTIILKG-
LCHENR---SQE--ALELLH--MM---ADDGGGCLPNVVSYSTVIDGLLKGGDP----DK
AYATYREM-L-DR-R-ILPNVVIYSSII--------------------------------
-----AALCKGQAMD--KAM-EVHDRM-VKNG-VTPNCFTYTSLVHGFCSSGQLTEAIKF
LEKMCS-NGVEPNVVTYSSFMDYLCK-NGRCTEARKIFD-SMVKRGLKPDITTYSSLLHG
YAIEGALVEMHGLFDLMVQS---DM-QPDHYVFNTLIYAS--------------------
----------AKQGKVDEAM-LVFSKMRQ-QG--LKPNCVTYSTLINGYCKITRMENALA
LFQEMV---SN-GVSPN-------------------------------------------
---FITYNIMLQGLFRTGRTATAKEFYVQ------IIKSGKK-DL---------------
-----------------IEQGLL-------------------------------------
------------------------------------------------------------
-------------EELDDLFLSMEDNDC--------------------------------
------------------------------------------------------------
-----STVSTPAC
>gi|125528002|gb|EAY76116.1|	   390 residues, 50 /line  hypothetical protein OsI_003963 [Oryza sativa (indica cultivar-group)]
---MAAAV--------------------------------------------RLLLRRRL
-STATAPPPTPGSILNPSSPST-PLTSRQKSRLAISL-----------------------
----------------------------LK--STPSPPPDQI-----------LSICRAA
ALSPDSHLD------RVAL-----------------------SL--AASKLSSAPDSVRD
LAS---------------------------------------------------------
------------------------------------------------------------
-----------SLLTPHHAPHAIALFGQAGL--LP-------------------------
-----------------------------------DAVSTF---KSSPSTRSLNALLFA-
CLVSGN---HAE--AARVFQ--TF---PDA-YSVKPNTDTFNAIIKSFAESGTT----RS
FYSVLDEM-C-KK-G-VKPNATTFTTAI--------------------------------
-----AGFYKEERFD--DVG-KVIELM-KKHG-CGESLPVFNVRVQGLCKLGRSGDAKAL
LNEMVK-KGTKPSWLTYNHLIHGFCK-EGDLEEAKRLYK-EMAKKGLVGDSSFYYMLIYY
LCKGGDFDTAVGVYNEIAAR---NW-VPCFSTMKMLVNGL--------------------
----------AGSSRVDEAK-GIIEKMKE-K-----------------------------
------------------------------------------------------------
----------------------------------------FPDKA---------------
-----------------EGWKEVE------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------DALPQ
>gi|125535814|gb|EAY82302.1|	   578 residues, 50 /line  hypothetical protein OsI_036261 [Oryza sativa (indica cultivar-group)]
-MPLATLLGHL-A----AG-RFGRVQALTGA--AT--------AAAAHRLLHLLLRTAPP
-PP-LPDLVSLARWSRAHFRAP-L-PLRLHGLLLARL-----------------------
----------------------------AS--K---GLYPLL-----------RSELHVL
AAARLHSPA------SILRALPSPSASASASTPLIADMLVL-------------------
----------------------ALARASQPLRAYD--------------AFLLAGESHPR
HRP-STSSVNALLAGLVG------------------------------------------
----------------------------AKR--VDLAEKAFRSALR--------RR--VS
P-DIYTFNTVISGLCRI--GQ-----LRKAGDV-AKDIKAW--G-LAPSVATYNSLIDG-
YCKKGGAGNMYH--VDMLLK--EM---VEA--GISPTAVTFGVLINGYCKNSNT----AA
AVRVFEEM-K-QQ-G-IAASVVTYNSLI--------------------------------
-----SGLCSEGKVE--EGV-KLMEEM-EDLG-LSPNEITFGCVLKGFCKKGMMADANDW
IDGMTE-RNVEPDVVIYTILIDGYRR-LGKMEDAMAVKE-AMAKKGISPNVTTYNCLITG
FSRSGDWRSASGLLDEMKEK---GI-EADVVTYNVLIGAL--------------------
----------CCKGEVRKAV-KLLDEMSE-VG--LEPNHLTYNTIIQGFCDKGNIKSAYE
IRTRME---KC-RKRAN-------------------------------------------
---VVTYNVFIKYFCQIGKMDEANDLLNE------MLDKCLVPNG---------------
-----------------ITYETIKEGMMEKGYTPDIRGC---------------------
------------------------------------------------------------
------------------------------------------------------------
-TVSQ-------------------------------------------------------
--ASEN---PASS
>gi|125537825|gb|EAY84220.1|	   486 residues, 50 /line  hypothetical protein OsI_005453 [Oryza sativa (indica cultivar-group)]
----------M-S----LVNRPLPALY-------------------------GICTASAK
-TRAW--------WLCRDGNLP-STSRISCTEPSNG------------------------
-----------------------------G--SAMELEVMDR-----------NEQTYHE
NSSASE-----------DEDDDEEEAVEWSKDELDAISALFDRP--MRQ----------K
PPKP--PNP-----VRQ---RPLPLPLPHKTRLPNA-------------PAPKQHIRLAA
-RA-ALSSRSSFSDQVCKN---------------P--------EVLIGIAR-EIAALPPE
SDVSIVLDRWVRFLRKGSLSMTIRELGHMGL--PERALQTLCWAQRQTV-----VP--LF
P-DDRILASTIEVLARF--DQ-----LK-----MEDALEQC---VPSASRAVLEAMVSG-
FIRAGK---VGL--ARKLLEFATI---NKR--TLSPSVH-VKLMLEAVRTPEGY----GL
AAALLDEL-G-ER-PELHVRQQDCTAVM--------------------------------
-----KVCVKLRRYA--AVE-SLFGWF-RDTG-GRPTVVMYTAVIHSRCRDGRHREALSL
AWEMERHAGGLLDLPAYRVLVKLCVA-LRDHERGVRYLA-RMKDAGFVPTGDMYGGLIGG
YAAEGRMGRCRRLIREAELA---GV-KLERRLLS--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------RLS
EMGV--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------EHSQL
>gi|125548275|gb|EAY94097.1|	   554 residues, 50 /line  hypothetical protein OsI_015330 [Oryza sativa (indica cultivar-group)]
---MASSSAAA-F-------------------------------SPTSHHSPPPLSPLHL
-RLRLRMLPSMMPRPATPARSP------PTTPSRPS------------------------
---------------------------------PPWRTPRAP-----------RRRWRCS
AASRHAPDLRRLMRLYVTAATAFVARGSLPMAHEVMRGMVAAFG--EA------------
----------------------------GRLPEAA--------------DMVLEMRSH-G
LPL-CVETANWVLRVGLET---------------G---SFVYARKVFDGMT-RAG-----
-----------VCPDERSFRALVVVCCREGK--VEEVDALLAAMWR--------YG--FS
L-DNATCTVVVRSLCEK--GR-----FKDVSEF-FRRMLEM--G-TPPNVVNYTAWIDG-
LCKRRY---VKQ--AFHVLE--EM---VGR--GLKPNVYTHTTLIDGLCKIGWT----ER
AFRLFLKLIK-SS-S-YKPNVHTYTVMI--------------------------------
-----GGYCREGKLA--RAE-MLLVRM-VEQG-LKPNTNTYTTLIGGHCKGGSFDRAFEL
MNKMKQ-EGFLPNIYTYNAVIDGFCK-KGKIQEAYKVLR-MATSQGLKFDKITYTILITE
HCKQGHITYALDLFDRMVEN---GC-CPDIEAYTSLISTY--------------------
----------CQQRQMEESQ-KFFDKCLM-IG--LLPTKQTYTSMIAGYCKVGRSTMALR
VFERMV---QN-GCFAD-------------------------------------------
---SILMCS---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------NNVVSATRHSPLHE
AHGLG-------------------------------------------------------
--ANRML-----D
>gi|125569916|gb|EAZ11431.1|	   563 residues, 50 /line  hypothetical protein OsJ_001256 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MAHEVMRGMVAAFG--EA------------
----------------------------GRLPEAA--------------DMVLEMRSH-G
LPL-CVETANWVLRVGLET---------------G---SFVYARKVFDGMT-RAG-----
-----------VSPMNRGFGALVVVCCREGK--VEEVDALLAAMWR--------YG--FS
L-DNATCTVVVRSLCEK--GR-----FKDVSEF-FRRMLET--G-TPPNVVNYTAWIDG-
LCKRRY---VKQ--AFHVLE--EM---VGR--GLKPNVYTHTTLIDGLCKIGWT----ER
AFRLFLKLIK-SS-S-YKPNVHTYTVMI--------------------------------
-----GGYCREGKLA--RAE-MLLVRM-VEQG-LKPNTNTYTTLIGGHCKGGSFDRAFEL
MNKMKQ-EGFLPNIYTYNAVIDGFCK-KGKIQEAYKVLR-MATSQGLKFDKITYTILITE
HCKQGHITYALDLFDRMVEN---GC-CPDIEAYTSLISTY--------------------
----------CQQRQMEESQ-KFFDKCLM-IG--LLPTKQTYTSMIAGYCKVGRSTLALR
VFERMV---QN-GCFAD-------------------------------------------
---SITYGALISGLCKESRLEEAKALYEG------MLDKRLVPCE---------------
-----------------VTRVTLTFEYCRREKTSIAVSVLDRLDKRQ-QVHTVDVVVRKL
SALGDV------------------------------------------------------
--------------------DAASLFLKKVLDEDYAVDHATYTGFINSCYENNRYALASE
MSEKF-------------------------------------------------------
--SKKISSFKEKR
>gi|125553492|gb|EAY99201.1|	   438 residues, 50 /line  hypothetical protein OsI_020434 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------MWGTTAAAVRRLCAAGD--VRSALAMLARGTK--------SG-DAA
L-DVTACTALVNGCCKG--GD-----VAEARRV-FDEMPLL--G-LAPNEVTYTALMHG-
YFTHGQ---REK--GFALFE--EM---RRG--GVEPNLYTYNCLIGEWCRTGEF----ER
ARSLFDEM-P-VR-G-IVRNVVSYNTLI--------------------------------
-----AGLCRHGKLW--DAA-KLLDMM-RTEG-TRPSIITFNLLVDGYGKAGKMSNALPF
FNQMKA-AGFQPSAVTYNMLIAGFCR-ARDMTRANRALS-DMKERGLEPTKVTYTILIDS
FARENHMGKAFEILAGMEKA---GL-EVDAHTYGVLVRAL--------------------
----------CMEGNMKDAR-KLFQSMGE-KG--VEPSNVIYDMMIYGYGREGSSYKALK
LIMEMR---QK-GLIPN-------------------------------------------
---SASYGLTIRVLCKDDKCQEAEALLDD------MVRAGLQTMG---------------
-----------------QALES--------------------------------------
------------------------------------------------------------
-----------------DSIRDKGLE------------------IVSVHDKGLEVNSAPE
PTDQV-----------------------------------------------------EA
AVLHKPKVNKNYL
>gi|125554437|gb|EAZ00043.1|	   579 residues, 50 /line  hypothetical protein OsI_021275 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------MGVYARS--GR-----FDDARQL-LDAMRDQ--D-IEPDLVSFNTLINA-
RAKSGC---LAAGVALELLH--EV---RQA--GLRPDAITYNTLISACSQGSNL----DD
AVAVFEEM-I-AS-E-CRPDLWTYNAMV--------------------------------
-----SVHGRCGKAQ--EAE-LMFKEL-VEKG-FQPDAVTYNSLLYAFAKEGDVERVERV
CEELVK-AGFRKDGITYNTMIHMYGK-MGRLDLALGLYD-EMRAIGCTPDAVTYTVLVDS
LGKMDRISEAGKVLEEMADA---GL-KPTLVTFSALICAY--------------------
----------AKSGRQDDAE-RTFDRMVE-SG--VKPDRLAYLVMLDVFARSDETRKLMV
LYRAMI---KD-GYKPD-------------------------------------------
---DGLYQVLLAALAKGNEHDEIEGVIQD------MEAVFEMNPL---------------
-----------------VISSILIKAECISQGASLLKRACLQGYEPDVEEKDWGADLRKL
SAGAALVALTLWLDQMQGAPESPKSIVLVTGEGEYNMVSLRKTIRAYLLEMGSPFLPCRS
RSGRFVVKA---YSLKMWLKDSPFCLDLELKDAPALPKTNSMKLTEGYFMRAGLVPVFKD
IHERLGEVWPKKFSRLALLSEESRDEVIKADIKGRKEKLEKMKKQGLAIAKRSKRGPRRG
KFVKQQSTQEVLK
>gi|125555457|gb|EAZ01063.1|	   552 residues, 50 /line  hypothetical protein OsI_022295 [Oryza sativa (indica cultivar-group)]
---MAAVGWHV-R--------------MKGR--RKGGGGGG-PLLALRLFLAPLHPAAV-
------------------------THHSFNSALLRFP-----------------------
----------------------------LP--PHLL------------------------
------PPFFSRSLR---------------------------------------------
-------------------------------------------------------RFPGR
LAP-TLLSFNLLLKCVCSSLVPRDP--------RR---YLDVALRILHEIIPGWD-----
-----------LAPDKFTYSTVVSALADAGR--VDDAVALVHEMVA--------DG--VV
A--AEAFNPVLRAMLRA--GD-----VKGAAKL-FEFMQLK--G-CVPTAATYNVLVHG-
LLVCGR---AGA--AMGVMR--RM---ERE--GVVPGVMTYGAVVDGLVRCGRV----KD
AWKVAEEM-E-RN-G-LARNEFVYSTVI--------------------------------
-----TGFCKSGEID--CAL-KVWEAM-VASP-VRPNVVLYSAMIGGLANFGKMTEAELL
FREMID-SKCAPNIITYGSMIQGYFK-IGDTSRALSVWE-EMIGAGCMPNAVSYSILING
LCNVGRLKDAMMVWKHMLDR---GC-APDTIAYTSMIKGL--------------------
----------CVSGMVDGGL-RLFYDMLA-SGH-ADPDVISYNVLLDGLLLAKDLPRAMD
LLNRML---DQ-GCDPD-------------------------------------------
---TVTCNIFLREFGAGERKGREF------------------------------------
-------------------LEGLVVRLCDRRRNMAAGEVLMVMLAKY-IVPEAPIWEMVV
R-----------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------DVCRRKRVW
RVIDKCWDEIWGP
>gi|125557677|gb|EAZ03213.1|	   483 residues, 50 /line  hypothetical protein OsI_024445 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------MTE--------
-------------------------------------------------------N-GVG
P-DLVTHNIVLSALKNG--AQ-----YSKAISY-FEIMKGA---NVTSDTFTLNIIIHC-
LVKIGQ---CGE--AIELFN--SM---RERRTKCPPDVVTYTSIMHSYCIYGQV----EN
CKAIFDLM-V-AE-G-VKPNIVAYNSLL--------------------------------
-----GAYASRGMHR--EAL-AIFNLI-KKNG-LRPDIVSYTSLLNAYGRSAQPEKAREV
FNKMKK-NSCKPNKVSYNALIDAYGS-AGMLKEAVGLLH-EMEKDGIQPDVVSISTLLAA
CGRCRQITRIETILEAARSR---GI-DLNTVAYNSGIKSY--------------------
----------LSFGDYEKAL-ELYTSMRE-SN--VKPDAVTYNILISGSSKLGKYTESLR
FFEDMV---DS-KVSSTKEFLWTIRWLEESLGPVQRDGSKWIRDWKTASEMIEYLDSSLS
SISVGTLNHVLNFLGKCGKTENMMKLFYK------MVTSCSTVGL---------------
-----------------STYAVVLRNLLVVGKWRKYIEVLQWMEDSG-VHPTLYMFQNVL
P-----------------------------------------------------------
------------------------------------------------------------
----------------------------YIWRENGMDFAATMQEKISMIRPT--------
-----LIIISRRL
>gi|125558723|gb|EAZ04259.1|	   528 residues, 50 /line  hypothetical protein OsI_025491 [Oryza sativa (indica cultivar-group)]
------MIVYD-S----KSS---------------SGGGVGDGGTGGGEVGS--------
-------GGSGGGGEVGRGGDG-GAGGVDGDSSIMAGA----------------------
-------------------------VCFGV--VAARGVIDCE-----------VPSMYCG
G-----------------------------------------------------------
--------------------------------------------------------GESR
LEP-DAPLFSDLISAFARA---------------R---LPDAALELLASAQ-AIG-----
-----------LTPRSNAVTALISSLGSARR--VAEAEALFLEFFL--------AG-EIK
P-RTRAYNALLKGYVKI--GS-----LKNAEQV-LDEMSQC--G-VAPDEATYSLLVDA-
YTRAGR---WES--ARILLK--EM---EAD--GVKPSSYVFSRILAGFRDRGEW----QK
AFAVLREM-H-AS-G-VRPDRHFYNVMI--------------------------------
-----DTFGKYNCLG--HAM-DAFDRM-REEG-IEPDVVTWNTLIDAHCKGGRHDRAIEL
FDEMRE-SNCPLGTTTYNIMINLLGE-EQRWEGVEAMLA-EMKEQGLVPNIITYTTLVDV
YGRSGRFKEAVDCIEAMKAD---GL-KPSSTMYHALVNAY--------------------
----------AQRGLADHAL-NVVKAMRA-DG--LEASTVVLNSLINAFGEDRRIAEAFS
VLQFMK---EN-GLRPD-------------------------------------------
---VITYTTLMKALIRVEQFEKVPVIYEE------MITSGCAPDR---------------
-----------------KARAMLRSALRYMKHMRV-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------A
>gi|125575277|gb|EAZ16561.1|	   526 residues, 50 /line  hypothetical protein OsJ_030770 [Oryza sativa (japonica cultivar-group)]
-MARRAASRAA-G-----------------------------------------------
-------------------------ALRSEGSIQGRGG----------------------
-------------------------RAGGS------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------GG---GAEDARHVFDELLR-RG-----
------------IPDVFSYNILLNGLCDENR--SQEALELLHIMAD--------DGGDCP
P-DVVSYSTVINGFFKE--GD-----L--------DKMLDQ---RISPNVVTYNSIIAA-
LCKAQT---VDK--AMEVLT--TM---VKS--GVMPDCMTYNSIVHGFCSSGQP----KE
AIVFLKKM-R-SD-G-VEPDVVTYNSLM--------------------------------
-----DYLCKNGRCT--EAR-KIFDSM-TKRG-LKPDITTYGTLLQGYATKGALVEMHGL
LDLMVR-NGIHPNHYVFSILVCAYAK-QEKVEEAMLVFS-KMRQQGLNPNAVTYGTVIDV
LCKSGRVEDAMLYFEQMIDE---GL-RPDSIVYNSLIHSL--------------------
----------CIFDKWEKAE-ELFLEMLD-RG--ICLSTIFFNSIIDSHCKEGRVIESGK
LFDLMV---RI-GVKPDIITL---------------------GRNDEAKDLFVAFSSNGL
VPNYWTYRLMAENIIGQGLLEELDQLFLS------MEDNGCTVDS---------------
-----------------GMLNFIVRELLQRGEITRAGTYLSMIDE---------------
------------------------------------------------------------
--------------------------------KHFSLEASTASLFIDLLSGGKYQEYHIF
LPEK--------------------------------------------------------
---YKSFIESLSC
>gi|125587013|gb|EAZ27677.1|	   499 residues, 50 /line  hypothetical protein OsJ_011160 [Oryza sativa (japonica cultivar-group)]
-MRRLLSAPL------------------------------------------------RR
-RLCTAAVAAAAPDPAL-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------ASSAELAYRLLRRHHSDP--------K--------------------------
--------------------------------------------------RLTAALSGSG
L-DPTSPRLLDASLAKT--GH-----VAVAEQL-VEELQPR----LPLSLRHYTALLYG-
WCRMGK---LDE--AKHVLA--RM---KAA--EVAPDVVVFNTLLAGFVADGRF----ED
AFELAREM-E-RR-G-CPPNAVSYTTLM--------------------------------
-----QGLGARGRVD--EAM-RVFVEM-RRKG-CAPDSVTYGTLVTAFCKAGRISQGYEF
LDVMAR-EGLRVDAGVYLGFFVAHEK-KEQLEECLELME-RMRECRCPPDLSIYNVVIRL
ACKLGETKQAVALWNEMETN---EL-SPGVDTFAIMVTGL--------------------
----------VGQGVLVEAC-GYFKDMVG-RGLFVAPQYGVLKDLLNSLVRDQKLELAKD
VWGCIM---TK-GCELN-------------------------------------------
---FGAWTIWIHALYAKKHVKEACMYCLD------MLDAGLMPQP---------------
-----------------DTFAKLMKGLKKLYNRQIAAEITEKVRKMA-------------
------------------------------------------------------------
----------------------------------EERHVSFK------------------
------MYKRRGVRDLEEKPKAKRKK----------------GQKRSRLRQAGQNQSNRH
ADKTDLFDDFDDE
>gi|125587900|gb|EAZ28564.1|	   550 residues, 50 /line  hypothetical protein OsJ_012047 [Oryza sativa (japonica cultivar-group)]
-MRRCGRIFF-------------------PP--SLKFVSHSGGR---------LSATRFS
-TTGFDLPDWFRNPKDDGSCAG-LDDEEDDIFVLP-------------------------
--------------------------------TEPNVSDERR-----------SQSST--
-----------------------SRSLSIRPGFPATASHEDAEF--EADI------DEVS
RILS--ARFASPEAIMI---AMDCCSVRVTGCLVDKILTRFSNDWVAAFGFFMWVGTQGG
YCH-CADSYD--------------------------------------------------
--------------------LMVDILGKFKQ--FDLMWGLINQMVEV----------GGL
M-SLMTMTKVMRRLAGA--SR-----WTEAIDA-FHKMDRF---GVVKDTKAMNVLLDT-
LCKERS---VKR--ARGVFQ--EL---RG---TIPPDENSFNTLVHGWCKARML----KE
ALDTMEEM-K-QH-G-FSPSVVTYTSLV--------------------------------
-----EAYCMEKDFQ--TVY-ALLDEM-RKRR-CPPNVVTYTILMHALGKAGRTREALDT
FDKLKE-DGVAPDASFYNSLIYILGR-AGRLEDAYSVVE-EMRTTGIAPNVTTFNTLISA
ACDHSQAENALKLLVKMEEQ---SC-NPDIKTYTPLLKLC--------------------
----------CKRQWVKILL-FLVCHMFR-KD--ISPDFSTYTLLVSWLCRNGKVAQSCL
FLEEMV---SK-GFAPK-------------------------------------------
---QETFDLVMEKL----------------------------------------------
---------------------------EKRNLQSVYKKIQVL------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---RTQSNFFKLD
>gi|125605710|gb|EAZ44746.1|	   581 residues, 50 /line  hypothetical protein OsJ_028229 [Oryza sativa (japonica cultivar-group)]
-MPPSPPLRHLLS----FRRRPLA--------------------------------PRFL
-LLPRRFSASASASALQAATPPPSSSSAARLAAAVH------------------------
-----------------------------G--SAASGGF---------------------
------------------------------------------------------------
------AHAIRLTKHLV---RA----------------SSFPSHCPGAAGAAAAAALAST
SAS-PAPALGVLVIALSQM---------------A---LPDEALSVFGRLRE--------
------------LPALPACNAILDGLVKAHM--LARVWELFDEMLG--------RG--MV
P-SVVTYNTLINACRHQ--GD-----VAKAWEV-WDQMVAR--R-IDPNVVTYTTMICA-
LCEEDC---IGD--AEGLFL--EM---KEA--GMRPNLYTYNALMSSHFKRDNI----KH
ALVFYYDL-L-KC-G-LVPNDVIFTTLI--------------------------------
-----DGLCQANRIT--EAK-NIFLDM-PRYE-VAPTVPVYNSLIHGAFRSGYAQEALAF
FQEIIR-KGLRPDEFTCSIVVRGLC-------DALVTCT-RMSEVGVEPHVVTYSSLIDG
HSKNGEMEIAMAIYTEMVAK---GV-EPNVVTYTALIHGH--------------------
----------AKNGDMDAAF-WLQKEMEE-KG--IYSNAITVSVLVDGLCRENRVQDAVR
FIMEYSGQKKS-EKNPSI------------------------------------------
-ANSVTYMTLIYGLYIDGQYNEACHFFSC------MRDSGMVPDR---------------
-----------------FTYTLVIRGLCMLGYVLNAMMLYADMVK---------------
------------------------------------------------------------
--------------------------------LDMRC-----------------------
------------------------------------------------VRSWEMGGVAEH
ERLVGQTVDCPSC
>gi|140067179|gb|ABO83338.1|	   467 residues, 50 /line  Pentatricopeptide repeat [Medicago truncatula]
----MGKIP---------------------P--SFRSALSNPNLIHRSSSLIPSSP----
-----KPHHFPNKTRKPHQKQ---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
QQS-QSQSQSPKPVSVFKS---------------P---NLQEAKSIFNSFVN-SSN----
-----------APIDSRFHNSLLQSYASIST--INDSIAFLRHMTK--------THPSFS
P-DKSTYHILLTHCCKS--TDSKYSTLSLIHQT-LNLMVSD--G-ISPDKGTVDLAVRS-
LCTADR---VDD--AVELIK--EL---SSK--HCSPDIYSYNFLVKNLCKSRTL----SL
VYAFIDEM-R-TKFD-VKPNLVTYTILI--------------------------------
-----DNVCNTKNLR--EAT-RLVDIL-EEEG-FKPDCFLYNTIMKGYCMLSRGSEAIEV
YNRMKE-KGVEPDLITYNTLIFGLSK-SGRVSEAKKLLR-VMAEKGHFPDEVTYTSLMNG
MCRKGETLAALALLEEMEMK---GC-SPNTCTYNTLLHGL--------------------
----------CKSRMFDKAM-ELYGAMKS-DG--LKLDMASYATFVRALCSVGRVADAYE
VFDYAV---ES-KSLSD-------------------------------------------
---VAAYSTLESTLKWFKKAKE--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------EGLKF
>gi|147776740|emb|CAN72416.1|	   422 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------WWEPHVKPSPIG
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------SPSRV---QKLIASQ---------------SDPLLAKEIFDLASLQPN
------------------------------------------------------------
-----------FKHSYSSFHILILKLGWARQ--FSLMQDLLMRLKS--------EQ--YS
I-NPSLFSDIIEIYGEA--NL-----PDQALKT-FHSMLQF--H-SKPLPKHLNXLLQL-
LVSHRN--YIRP--AFDLFK--SA---HRY--GVSPDTKSYNILMSAFCFNGDL----SI
AYTLFNQM-F-KR-D-VAPDVESYRILM--------------------------------
-----QGLCRKSQVN--RAV-DLLEDM-LNKG-YVPDALSYTTLLNSLCRKKKLKEAYKL
LCRMKV-KGCNPDIVHYNTVILGFCR-EGRXLDACKVLE-DMPSNGCSPNLMSYGTLVSG
LCDQGLYDEAKNYVEEMLSK---GF-SPHFSVFHALINGF--------------------
----------CNVGKLEEAC-EVLXEMLR-HG--EAXHTETWVAIIPRICEVDKLVRMEN
IFDEXL---KL-EITPN-------------------------------------------
--------------------------------------------T---------------
-----------------RLVEAGIGL----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------EE
YVIRKVRDKSRKA
>gi|87240852|gb|ABD32710.1|	   451 residues, 50 /line  Tetratricopeptide-like helical [Medicago truncatula]
-MHRSFTVLSKN-----------------LK--SIASSSSSDGIFSFKFHSSSSSSSPIG
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------SPTRV---QKLIASQ---------------SDPLLAKEIFDYASLQPN
------------------------------------------------------------
-----------FRHNYSTYLILILKFGRSKH--FSLLDDLLRRLKS--------ES--SQ
PITPTLFSYLIKIYGEA--NL-----PDKALNT-FYIMLQF--N-IKPLTKHLNRILDI-
LVSHRN--YLRP--AFDLFK--DA---HKH--GVFPDTKSYNILMRAFCLNGDI----SI
AYTLFNKM-F-KR-D-VVPDIQSYRILM--------------------------------
-----QALCRKSQVN--GAV-DLFEDM-LNKG-FVPDSFTYTTLLNSLCRKKKLREAYKL
LCRMKV-KGCNPDIVHYNTVILGFCR-EGRAHDACKVID-DMQANGCLPNLVSYRTLVNG
LCHLGMLDEATKYVEEMLSK---GF-SPHFAVIHALVKGF--------------------
----------CNVGRIEEAC-GVLTKSLE-HR--EAPHKDTWMIIVPQICEVDDGVKIDG
VLEEVL---KI-EIKGD-------------------------------------------
--------------------------------------------T---------------
-----------------RIVDAGIGL----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------ED
YLIRKIRAKSRQF
>gi|147784915|emb|CAN72973.1|	   550 residues, 50 /line  hypothetical protein [Vitis vinifera]
-MVKSPPLKALS--------------LFTSS--ALQGXQHTHQS--ISFILHLLISSNLF
-SHSQSLLLKLISGQISSSSFTPS------------------------------------
------------------------------------------------------------
---------------SLFHELTQPHLDSFPTHVLIHEAIINAHV--RS------------
----------------------------QLPEQAL--------------FYXNQMIGR-G
LVP-GSNTFNNLLILLIKS---------------N---FFEKAWRVFNETK--GN-----
-----------VKLDVYSFGIMIKGCCEVGY--LDKGFEVLGQMEE--------MG--LS
P-NVVVYTTLIDGCCKN--GD-----IERGKQL-FYKMGEL--D-VVANQYTYTVLING-
FFKMGL---KKD--GIELYE--KM---KLT--GIVPNVYTYNSMICRCCNDGKL----NN
AFELFDEM-R-ER-G-VACNVVTYNTLI--------------------------------
-----GGLCQERRVL--EAE-RLMCRM-KRDG-LSPNLISYNTLIDGYCSIGNLDKASSL
FNQMKS-SGQSPSLATYNILIAGFSE-AKNSAGVTDMVR-EMEARGLSPSKVTYTILMDA
LVRSDNIEKAFQIYSSMEKA---GL-VADIYIYGVLIHGL--------------------
----------CVVGDMKEAS-KLFKSLDE-MH--LKPNDVIYNTMIYGYCKEGSSYRALR
LLKEMG---EN-GMVPN-------------------------------------------
---VASYNSTIXILCKDEKWTEAEVLLKD------MIELGLKPSI---------------
-----------------SIWNMISKAR---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------FDNV
>gi|147799110|emb|CAN63706.1|	   390 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----------MA----MLRPPSFSKTNFLR--KRRKWPLSP------------------
--YKATWHETFHHRQ---------------------------------------------
------------------------------------------------------------
---------------AMQTLKNTIANQSPSPQSPSNSQFLSILI--DSF-----------
--------------------------------------------------------RIYN
SDP-TPNAYRFVISTLTRC-----------------------------------------
-----------------------------RQ--FHHLPPLLHRLEKVE----------KF
ETPEFI--------------------FTNLIKI-LLKSQAM--N-IRLEESSFRILVAA-
LCRIKK---HNY--AIRILN--YM---LND--GYAVDAKMCSIILSSLCEQKGLSG--DE
VLRFMEEM-R-KL-G-FYPGRVDCNNVI--------------------------------
-----XFLVKEGMVM--DAL-GVFDQM-KTDG-IKPDTVSYTMILNGVTADGDYEKADDL
FDEMLV-LGVVPDIHAYNVYINSLCK-QNNIEEGVRMLA-SMRELGCKPDYVXYNMLLEG
MSKVRDLGGMRELAREMELE---GV-QWNWETYRIMLDGL--------------------
----------VGKGEIDESC-SLVGGNVX-QVFL--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----LLVVRHLMK
>gi|147814819|emb|CAN74746.1|	   514 residues, 50 /line  hypothetical protein [Vitis vinifera]
-MERLFSSLSICT----VPGTRIYWDKRYVK-AQFVVEFSNKNEIKLGVQCNARVNHRKP
-TKNLPHPRRAKLPPEPEISTF-LKGGNSGTEQ---------------------------
----------------------------------SEMGTVLD-----------KELDPND
DGFLVD-----------GIEGRKEGEIVWDSDEIEAISSLFMGR--IPQKPGKLNRERPL
PLP---------LPYKI---RPMGLPTTK--------------RHVRAASSMPYASRASL
SKQ-VYKNPDFLISIAREI-----------------------------------RNLPLE
DDVSPVLNKWVRFLRKGSLSLTIRELGHMGL--PERALQTFFWAQKQPQL----------
FPDDRILASTVEVLART--HKLK----------VPFSLEKF---TGLATRSVIEALARG-
FIRRGS---LSL--AWKLLLVA-----KDS--KRMLGPSIYAKLIFELGKNPDKH---SL
VQALLDEL-G-ERE-DLKLSHQDCTAVM--------------------------------
-----KVCIRLGKFE--IVE-SLFNWY-KQSE-NSPSVVMYTTLIHSRYTEKKYREALAV
VWEMEA-SDCLFDLPAYRVVIKLFIA-LNDLSRTGRYFS-KLKEAGFSPTYDIYRDMLKI
YMVFRRLAKCREVCKELEMS---GF-KLDKGTLSQLLQLE--------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------RENR
>gi|147834641|emb|CAN60904.1|	   580 residues, 50 /line  hypothetical protein [Vitis vinifera]
---MAGXTISR-----------------------ARSLSNKSCCFH--------------
----APMGASLRPXFLGSAANTPNAGDTNSSTFHFSFN----------------------
-------------------------RNFNSLASSESTPPITZ-----------EVISKSV
LSSQWHFIE---------------------------------------------------
------QVSPNLTPALI---SN--------------VLYNLCSKPQLVSDFIHHL---HP
HCL-DTKSYCLAVVLLARLPSPKLALQLLKQVMET---RIATNRELFDELT---------
-----------LSRDRLSVKSSIVFDLLEGK--LKKAREFIGFMEG--------LG--FK
P-NVVSYNTIIHGYSSR--GN-----IEGARRI-LDAMRVK--G-IEPDSYTYGSLISG-
MCKEGR---LEE--ASGLFD--KM---VEI--GLVPNAVTYNTLIDGYCNKGDL----ER
AFSYRDEM-V-KK-G-IMPSVSTYNLLV--------------------------------
-----HALFMEGRMG--EAD-DMIKEM-RKKG-IIPDAITYNILINGYSRCGNAKRAFDL
HNEMLS-KGIEPTHVTYTSLIYVLSR-RNRMKEADDLFE-KILDQGVSPDVIMFNAMIDG
HCANGNVERAFMLLKEMDRK---SV-PPDEVTFNTLMQGR--------------------
----------CREGKVEEAR-MLLDEMKX-RG--IKPDHISYNTLISGYGRRGDIKDAFX
VRDEML---SI-GFNPT-------------------------------------------
---LLTYNALIKCLCKNQEGDLAEELLKE------MVNKGISPDD---------------
-----------------STYLSLIEGMGNVDTLVE-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------DNAS
>gi|15226343|ref|NP_178283.1|	   559 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
-MVRE-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------ALQFLSRLRKSSNLPDPFTCNKHIHQLI--NS------------
----------------------------NCGILSL--------------KFLAYLVSR-G
YTP-HRSSFNSVVSFVCKL---------------G---QVKFAEDIVHSMP-RFG-----
-----------CEPDVISYNSLIDGHCRNGD--IRSASLVLESLRAS-------HGFICK
P-DIVSFNSLFNGFSKM--KM-----LDEVFVY-MGVML-K--C-CSPNVVTYSTWIDT-
FCKSGE---LQL--ALKSFH--SM---KRD--ALSPNVVTFTCLIDGYCKAGDL----EV
AVSLYKEM-R-RV-R-MSLNVVTYTALI--------------------------------
-----DGFCKKGEMQ--RAE-EMYSRM-VEDR-VEPNSLVYTTIIDGFFQRGDSDNAMKF
LAKMLN-QGMRLDITAYGVIISGLCG-NGKLKEATEIVE-DMEKSDLVPDMVIFTTMMNA
YFKSGRMKAAVNMYHKLIER---GF-EPDVVALSTMIDGIAKNGQLHEAIVYFCIEKAND
VMYTVLIDALCKEGDFIEVE-RLFSKISE-AG--LVPDKFMYTSWIAGLCKQGNLVDAFK
LKTRMV---QE-GLLLD-------------------------------------------
---LLAYTTLIYGLASKGLMVEARQVFDE------MLNSGISPDS---------------
-----------------AVFDLLIRAYEKEGNMAAASDLLLDMQRRG-LVTAVSDA----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
DCSKQCGNEVNCS
>gi|15228825|ref|NP_188906.1|	   562 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
---MLTKLR------------ISKLVSYTLP--------------------RRIFQRRFL
VTNNTAEESPIVAAESPELPSW---------------I----------------------
-------------------------KDFLSNKPSSSSSSVSK------------DDEDFV
IPSLANWVE------SQKFSRQQVSEGNVVKKPVEDIDKVCDFL--NK-KDTSHEDVVKE
L--S--KCDVVVTESLV---L--------------QVLRRFSNGWNQAYGFFIWANSQTG
YVH-SGHTYN--------------------------------------------------
--------------------AMVDVLGKCRN--FDLMWELVNEMNK--------NEESKL
V-TLDTMSKVMRRLAKS--GK-----YNKAVDA-FLEMEKS-YG-VKTDTIAMNSLMDA-
LVKENS---IEH--AHEVFL--KL---FDT---IKPDARTFNILIHGFCKARKF----DD
ARAMMDLM-K-VT-E-FTPDVVTYTSFV--------------------------------
-----EAYCKEGDFR--RVN-EMLEEM-RENG-CNPNVVTYTIVMHSLGKSKQVAEALGV
YEKMKE-DGCVPDAKFYSSLIHILSK-TGRFKDAAEIFE-DMTNQGVRRDVLVYNTMISA
ALHHSRDEMALRLLKRMEDEEGESC-SPNVETYAPLLKMC--------------------
----------CHKKKMKLLG-ILLHHMVK-ND--VSIDVSTYILLIRGLCMSGKVEEACL
FFEEAV---RK-GMVPR-------------------------------------------
---DSTCKMLVDELEKKNMAEAKLKI-QS------LVQSKTMIDS---------------
-----------------HS-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------PLSVS
>gi|15234269|ref|NP_192906.1|	   566 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
---MAAKSQKTLVLLANLIKFPPLKAFSLLNSPNFHEFQHTHES--ISILLRLLLSGNLF
-SHAQSLLLQVISGKIHSQFFTSS------------------------------------
------------------------------------------------------------
---------------SLLHYLT--ESETSKTKFRLYEVIINSYV--QS------------
----------------------------QSLNLSI--------------SYFNEMVDN-G
FVP-GSNCFNYLLTFVVGS---------------S---SFNQWWSFFNENK--SK-----
-----------VVLDVYSFGILIKGCCEAGE--IEKSFDLLIELTE--------FG--FS
P-NVVIYTTLIDGCCKK--GE-----IEKAKDL-FFEMGKL--G-LVANERTYTVLING-
LFKNGV---KKQ--GFEMYE--KM---QED--GVFPNLYTYNCVMNQLCKDGRT----KD
AFQVFDEM-R-ER-G-VSCNIVTYNTLI--------------------------------
-----GGLCREMKLN--EAN-KVVDQM-KSDG-INPNLITYNTLIDGFCGVGKLGKALSL
CRDLKS-RGLSPSLVTYNILVSGFCR-KGDTSGAAKMVK-EMEERGIKPSKVTYTILIDT
FARSDNMEKAIQLRLSMEEL---GL-VPDVHTYSVLIHGF--------------------
----------CIKGQMNEAS-RLFKSMVE-KN--CEPNEVIYNTMILGYCKEGSSYRALK
LLKEME---EK-ELAPN-------------------------------------------
---VASYRYMIEVLCKERKSKEAERLVEK------MIDSGIDPST---------------
-----------------SILSLISRA-KNDSHVS--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------SK
>gi|15235161|ref|NP_195672.1|	   563 residues, 50 /line  EMB2453 (EMBRYO DEFECTIVE 2453); binding [Arabidopsis thaliana]
-MDY-------------LLTSPSSLRFSDFISSIPKETDHKWLR----------------
-----------------FSVNLGDARRSTRTRITCGAI----------------------
-------------------------SSRRKLAERESAERENR-----------V------
----------------------------------------LVRS--LMSRISDREP----
------------------------------------------------------------
------------------------------------------------------------
--LVKTLDKYVKVVRCDH------------------------------------------
------CFLLFEELGKS--DK-----WLQCLEV-FRWMQKQ--RWYIPDNGVYSKLISV-
MGKKGQ---TRM--AMWLFS--EM---KNS--GCRPDASVYNALITAHLHTRDKAKALEK
VRGYLDKM-K-GIER-CQPNVVTYNILL--------------------------------
-----RAFAQSGKVD--QVN-ALFKDL-DMSP-VSPDVYTFNGVMDAYGKNGMIKEMEAV
LTRMRS-NECKPDIITFNVLIDSYGK-KQEFEKMEQTFK-SLMRSKEKPTLPTFNSMIIN
YGKARMIDKAEWVFKKMNDM---NY-IPSFITYECMIMMY--------------------
----------GYCGSVSRAR-EIFEEVGE-SD--RVLKASTLNAMLEVYCRNGLYIEADK
LFHNAS---AF-RVHPD-------------------------------------------
---ASTYKFLYKAYTKADMKEQVQILMKK------MEKDGIVPNK---------------
-----------------RFFLEALEVFGSRLPGSGSENRKSTRSSRSRDSPKGRGGNQLT
EFQD--------------------------------------------------------
-KDNKHVFRAVQ------------------------------------------------
---------------------DCRKNYLENLSGHDKGSRDESRKPSQEKQPLFASDQNNM
MIKEKKELFTRVL
>gi|18394846|ref|NP_564110.1|	   537 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
-----------MALLRSKLHLSRTL-----------------------SFISPLLPKTFS
----------------------------------TSAT----------------------
-------------------------SLLSDHEND--ESAATI-----------TAAVSVP
ISPLLTPEDTQTVEKFHSIIKDHYRKNPTSPNDAILNPSLTLHA--LSLDFSQIE-----
--------TSQVSPSVV---RCVIEKCG---------SVRHGIPLHQSLAFFNWATSRDD
YDH---------------------------------------------------------
-------------KSPHPYNEMIDLSGKVRQ--FDLAWHLIDLMKS--------RN--VE
I-SIETFTILIRRYVRA--GL-----ASEAVHC-FNRMEDY--G-CVPDKIAFSIVISN-
LSRKRR---ASE--AQSFFD--SL---KDR---FEPDVIVYTNLVRGWCRAGEI----SE
AEKVFKEM-K-LA-G-IEPNVYTYSIVI--------------------------------
-----DALCRCGQIS--RAH-DVFADM-LDSG-CAPNAITFNNLMRVHVKAGRTEKVLQV
YNQMKK-LGCEPDTITYNFLIEAHCR-DENLENAVKVLN-TMIKKKCEVNASTFNTIFRY
IEKKRDVNGAHRMYSKMMEA---KC-EPNTVTYNILMRMF--------------------
----------VGSKSTDMVL-KMKKEMDD-KE--VEPNVNTYRLLVTMFCGMGHWNNAYK
LFKEMV---EEKCLTPS-------------------------------------------
---LSLYEMVLAQLRRAGQLKKHEELVEK------MIQKGLV------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------ARPL
>gi|18396782|ref|NP_566222.1|	   508 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
-------MSWL------IQNRIGNTLLRLNPS----------------------------
-SSSIAIFSTFIKNLSTASEQLP-------------------------------------
------------------------------------------------------------
----------------------------ETLDEYSQSEEIWNVIVGRDGDRDSEDDVFKR
LSSDEICKRVNLSDGLV---H--------------KLLHRFRDDWRSALGILKWAESCKG
HKH-SSDAYD--------------------------------------------------
--------------------MAVDILGKAKK--WDRMKEFVERMRG--------DK--LV
--TLNTVAKIMRRFAGA--GE-----WEEAVGI-FDRLGEF--G-LEKNTESMNLLLDT-
LCKEKR---VEQ--ARVVLL--QL---K-S--HITPNAHTFNIFIHGWCKANRV----EE
ALWTIQEM-K-GH-G-FRPCVISYTTII--------------------------------
-----RCYCQQFEFI--KVY-EMLSEM-EANG-SPPNSITYTTIMSSLNAQKEFEEALRV
ATRMKR-SGCKPDSLFYNCLIHTLAR-AGRLEEAERVFRVEMPELGVSINTSTYNSMIAM
YCHHDEEDKAIELLKEMESS---NLCNPDVHTYQPLLRSC--------------------
----------FKRGDVVEVG-KLLKEMVT-KHH-LSLDESTYTFLIQRLCRANMCEWAYC
LFEEMI---SQ-DITPR-------------------------------------------
---HRTCLLLLEEVKKKNMHESAERIEHI------MKTVKL-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------TAPVK


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.