FANDOM


In the plant Arabidopsis thaliana, At2g01860.1 is a gene model for the locus At2g01860.[1]

This gene model is classified by TAIR as "pentatricopeptide (PPR) repeat-containing protein". It is located on chr2, region 388282-389742 FORWARD.

Physiological functionEdit

At2g01860.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g01860.1/Expression

Subcellular localizationEdit

At2g01860.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g01860.1 has 486 amino-acid residues and a molecular weight Mw = 55.663 kDa.

The protein is relatively basic; at the physiological pH 7.4, its net charge is 14.66, or 0.030 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g01860.1/Knockout

Protein interactionsEdit

At2g01860.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g01860.1 has 4 recognized domains:

  • Domain_0434_0468 PPR domain (PF01535, IPR002885) Description: Pentatricopeptide repeat_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g01860.1
MILHCPVSLS LSFHLNLRTS RIGNIGVTRV NASQRNHSKK LTKNLRNPRR TKLPPDFGVN LFLRKPKIEP LVIDDDDEQV QESVNDDDDA VVWEPEEIEA ISSLFQKRIP QKPDKPSRVR PLPLPQPHKL RPLGLPTPKK NIIRSPALSS VSKQVYKDPS FLIGLAREIK SLPSSDADVS LVLNKWVSFL RKGSLSTTIR ELGHMGLPER ALQTYHWAEK HSHLVPDNRI LASTIQVLAK HHELKLLKFD NSLASKNVIE AMIKGCIEGG WLNLARKLIL ISKSNNRILD SSVYVKMILE IAKNPDKYHL VVALLEELKK REDLKLSQQD CTSIMKICVK LGEFELVESL FDWFKASNRE PSVVMYTTMI HSRYSEQKYR EAMSVVWEME ESNCLLDLPA YRVVIKLFVA LDDLGRAMRY YSKLKEAGFS PTYDIYRDMI SVYTASGRLT KCKEICKEVE DAGLRLDKDT SFRLLQLEKQ TMSLLH
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.