FANDOM


>gi|30677954|ref|NP_849924.1|	   359 residues, 50 /line  RIE1 (RING-FINGER PROTEIN FOR EMBRYOGENESIS); zinc ion binding [Arabidopsis thaliana]
-----MSSYSSD-ST--AARDQHAPLLRPRHDGSFSS----------SSSSARP-TAL--
AVLLGRI-TGH---RAPSMLVRETAARALEERRIDWG----YSKPVVAADILWNAALVLA
SAVMLVGTVEERPN-EPIRVWICVYGL---------------------------------
-------QCLFHVVLVWSEYW-----RRNSTRR------ARDLESYDHEDYNIEYDYEQD
S--------------------DDN--STTYSFVK-------------RCESINTVISFIW
WI-----------------IGFYWVVEGGDKLL---------GEAPN---LYWLSVIFLA
IDVFFAVFC-VVLACLVGIA--------------------------------------LC
CCLP-----------CIIA-LLYA-------VAGTEGVSEAELGVLPLYKFKAFHSNEKN
IT--GPGKMVPI--PINGLCLATERTL---LAED-ADC----CICLSSYEDGAELHALP-
CNHHFHSTCIVKWL-K-MRATCPLCKYNILKGTTDQS-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|115435944|ref|NP_001042730.1|	   329 residues, 50 /line  Os01g0276600 [Oryza sativa (japonica cultivar-group)]
---MAEEAAAGG------------------------------------------------
--------------LYYCHMCASTVSAVAAAE-GEVE----IKCPYC-------------
-----------------------HSGFVEEIESARGVAT---GGGGA-------------
-----ISSVWAPIIDGMVGGGGGDAVRRHRRSRRLADAAGADDGY---------------
--------------------YRDL--ALLDFSES--------------RRRTAALLLLMQ
EF--------------RERQLQRLESATA------------------------------T
ISAAAAE-------------AGAVVGT-------------SRDAEGVALADYFLGPGLDA
LMQR------------VGD-G----D---AGRQGTLPAKKEAVESMPTVEVAAGG-----
-------------------------------DCD-SAC----AVCLEDYAAGERATEMP-
CRHRFHAKCIVPWL-K-MHSSCPVCRFQLPTDDDDDSS----KSARGGAAHSGGGRR---
----------LSQPAPRVDGGGLGRLP---------------------------------
--------------------------AVMQELRSILS-----------------------
-------------------------QPSPASTSGS----------SSHAQQHSDE-----

>gi|145345425|ref|NP_194388.2|	   335 residues, 50 /line  protein binding / zinc ion binding [Arabidopsis thaliana]
MSTRYSSQLQSS-AIN-SITVSSS-----SSFASTQLDDNTHTAPE----SSPS-SSF--
FMRLAMR-VSR---ARWFIFLRR-VFHYQNASRSDLGTNPFNSIAWMVSELIALLLQITV
ITSTLALSKNERPV-WPMRLWITGYNV---------------------------------
-------GCLLNLMLLYGRYR-----QQDTSHE--------NAFSFGDIEQQQRS-----
---------------------REET-TRCSHLMN-------------KCRTSLELFFAIW
FV-----------------IGNVWVFDSRFGSF---------HYAPI---LHVLCISLLA
WNAL-----CYSFPFLLFLL--------------------------------------LC
CVVP-----------LVSSFLGYNM----NVGSSEKGASDDQISSLPSWKYKLIDET---
----------------------SDSSQ---ANND-PEC----CICLAKYKEKEEVRKLP-
CSHRFHLKCVDQWL-R-IISCCPLCKQDLPN-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|147819085|emb|CAN74282.1|	   343 residues, 50 /line  hypothetical protein [Vitis vinifera]
MNTRYFFPPD-S-LCNSGISVSFSSL---SPAGEDRMAAGVRNRSS----RAPP-SSF--
LIRTAMR-ISR---ARWFSFLRR-VFHYQNGSRSDLGANPFNSNTWMILEFIALVVQIGV
ITFTLSVSKAERPV-WPMRIWIVGYDF---------------------------------
-------GCVLSLLLLYWRYQ-----RPYSAQG--------DGFSLPDIEQQ-RN-----
---------------------NEE--SRSSHLMN-------------KCRTSLELFFAIW
FV-----------------MGNVWVFDSRFGSF---------HRAPK---LHVLCITLLA
WNAI-----SYSFPFLLFVL--------------------------------------LC
CCVP-----------LVSNLLGYNM----NMGSVDKGASDDQISRLPSWRFKEANANLDL
P-----------------NGADSNSPL---SSEY-PEC----CICLAKYREKEEVRQLP-
CSHMFHLKCVDQWL-R-IISCCPLCKQEIER-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|18423810|ref|NP_568834.1|	   343 residues, 50 /line  zinc finger (C3HC4-type RING finger) family protein [Arabidopsis thaliana]
MNTRYSNQPELS-SSNITITISSSALLSSSPRGDNSHVAAA-NGQE----RS-P-SSF--
YIRLAMK-VSR---ARWFIFLRR-VFHYQNGSRSDLGSNPFNSSTWMMSELIALLVQLTV
ITFTLAISKEERPI-WPVRLWITGYDV---------------------------------
-------GCLLNLMLLYGRYR-----QLDINQG--------NGFVLGDVEQQQRG-----
---------------------REE--TRSSHLMN-------------KCRTSLELFFAIW
FV-----------------IGNVWVFDSRFGSF---------HHAPK---LHVLCVSLLA
WNAI-----CYSFPFLLFLF--------------------------------------LC
CLVP-----------LISSLLGYNM----NMGSSDRAASDDQISSLPSWKFKRID---DS
A-----------------SDSDSDSAT---VTDD-PEC----CICLAKYKDKEEVRKLP-
CSHKFHSKCVDQWL-R-IISCCPLCKQDLPR-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|92888300|gb|ABE89318.1|	   333 residues, 50 /line  Zinc finger, RING-type [Medicago truncatula]
-------------------MVSFSSN---YAIGENSMASSVQTMPQPTTLSQDQ-PSF--
LTRMAMR-ISR---SRCFNFLRR-VFHYQNGPRSDLGSNPFNSSTWMMCELIALLIQITS
STFTLAISKSEKPV-WPMRVWIVGYDI---------------------------------
-------GCVLNLLLLYGRYH-----QINGTNG--------DALGLSDLEQQTNN-----
---------------------EENSVYRSTHLMS-------------KCRSSLELFFAIW
FV-----------------MGNVWSFDSRFGTL---------QQAPK---LQVLCIILLV
WNAI-----CYSFPFLLFLL--------------------------------------LC
CVVP-----------LISTLLGYNM----NIGSSSKGASDDQISQLPSWRFKVAHTKVDV
N-----------------NDSQCSERL---IADE-PEC----CICLAKYKDKEEVRQLP-
CSHMFHLKCVDQWL-R-IISCCPLCKQGLQR-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|84994748|ref|XP_952096.1|	   296 residues, 50 /line  hypothetical protein TA14195 [Theileria annulata strain Ankara]
-----MNTNISN-NNQL----NYNDTLYTQF-----------------------------
------------------------------------------------------------
-----------------------NNSPVDGVNIGPNRIRRNSSVPVVFYRND--------
----------------------------QISRRNRNNETLSANRYPMPNRQLSSPIHSN-
--------------------VHYY--PFYSINLMNRHTEIMRIHEELSRYHNVIQSRLLS
SP--------------RFNPTNTNNSVNTINT---INTVNSINMANN-------------
------------------LTPRNMVGNDYIYITNNVYSGSGLGSSRVNSLDTRSFSRVN-
--------------------------------SDLSHLNQAQISTIPTQSINLVEPIEVQ
LPPE------ILESFPVNLFTGDSGEL---DES-LRSC----SVCLEEYQQGDEIRRLP-
CTHSFHKRCIDTWL-K-KSTICPICKFNYIIMMQ--------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------I

>gi|125540651|gb|EAY87046.1|	   273 residues, 50 /line  hypothetical protein OsI_008279 [Oryza sativa (indica cultivar-group)]
-----MATPRSP-SPRGDARLDSAPLLGGGGGGGGRR----------HGGALRR-PSLRG
AARFLRR-SGRRAMRGASLLLSLGDLEQVPLSVNPLR----YIL----------LHLFLF
C-----------------------------------------------------------
------------------------------------------------------------
-----------------------------QNIAK-------------HLESANTMFSFIW
WI-----------------IGFYWVSAGGQVLT---------HDAPQ---LYWLCIVFLA
FDVFFVVFC-VALACIIGIA--------------------------------------VC
CCLP-----------CIIA-ILYA-------VSDQEGASEDDIRQIPRYKFRRMDEPEKQ
S-VNMTGSSG-GIMIECGTNQPIEKVL---AAED-ARTTLLCNRILGLLWNKGKVKD---
---------FDRTL-K-I-------PLKILQNGPFHKD----------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------F-E-----

>gi|125583230|gb|EAZ24161.1|	   335 residues, 50 /line  hypothetical protein OsJ_007644 [Oryza sativa (japonica cultivar-group)]
-----MATPRSP-SPRGDARLDSAPLLGGGGGGGGRR----------HGGALRR-PSLRG
AARFLRR-SGRRAMREPSLLVREPAADQLEERQADWA----YSRPVVALDLLWNLAFILG
CRRRARAEPRREP-----------------------------------------------
----------VHAAPPLDRWV-----RRSV------------------------------
-----------------RPPHGLR--RHRVPIAK-------------HLESANTMFSFIW
WI-----------------IGFYWVSAGGQVLT---------HDAPQ---LYWLCIVFLA
FDVFFVVFC-VALACIIGIA--------------------------------------VC
CCLP-----------CIIA-ILYA-------VSDQEGASEDDIRQIPRYKFRRMDEPEKQ
S-VNMTGSSG-GIMIECGTNQPIEKVL---AAED-AEC----CICLSAYDDGAELRELP-
CGHHFHCVCIDKWL-H-INATCPLCKFNVRKNSSSSGS----------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------EEV-----

>gi|147777193|emb|CAN65431.1|	   342 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----MSTARSS-AD----ATDTTPLLHASVSDQILR----------SRRLIRRPPSLRG
AARFLRRASSRRIMREPSMRVRETAAEQLEERQSDWA----YSKPIVILDIVWNLAFVVV
AMTVLVMSRDETPS-TPLRLWIIGYGL---------------------------------
-------QCVLHMVCICVEYK-----RRRHLAS------SGAVERSGGWGSGHLSSSSGS
D--------------------------EGDPIDY-------------RV-----------
------------------------------EVR---------NRVED---ETRLCIVFLA
FDVFFVVIC-VAVACVIGIA--------------------------------------VC
CCLP-----------CIIA-ILYT-------VADQEGATKEEIERLPKYKFRRIGESEK-
LNGEIQESFG-GIMTECDTDTPMEHVI---PQED-AEC----CICLSAYEDETELRELP-
CRHRFHCTCIDKWL-Y-INATCPLCKLNILKNASQSGC----------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------EGG-----

>gi|79317862|ref|NP_001031032.1|	   337 residues, 50 /line  protein binding / zinc ion binding [Arabidopsis thaliana]
------------------------------------------------------------
-------------MREPSMLVREAAAEQLEERQSDWA----YSKPVVVLDIVWNLAFVSV
ATAILVMSRKEHPI-MPLRVWLLGYAL---------------------------------
-------QCVLHMVCVCVEYR-----RRNRRRT------NRTTTTTPPRSRSSSSSSSSS
SLEEEALGSRRNSGVQDLSLGHLD--TESSSVAK-------------HLESANTMFSFIW
WI-----------------IGFYWVSAGGQELA---------QESPR---IYWLSIVFLG
FDVFFVVFC-VALACVIGIA--------------------------------------VC
CCLP-----------CIIA-VLYA-------VADQEGASKEDIEQLTKFKFRKLGDANKH
TNDEAQGTTE-GIMTECGTDSPIEHTL---LQED-AEC----CICLSAYEDGTELRELP-
CGHHFHCSCVDKWL-Y-INATCPLCKYNILKSSNL-DR----------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------EEV-----

>gi|38344371|emb|CAE02249.2|	   324 residues, 50 /line  OSJNBb0032E06.5 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
-------------MREPSVLVREAAAEHLEERQADWA----YSRPVVALDLLWNLAFITV
AAVVLVLSRGEDSP-MPLRTWVAGYAL---------------------------------
-------QCVVHMVCVAIEYR-----MRRGQRD------RAPASADEERGSDGSSSSSDD
DVTED---DRRGSC------------TDCVSIAK-------------HLESANTMFSFIW
WI-----------------IGFYWISAGGEDVI---------RDAPQ---LYWLCIVFLA
FDVFFVVFC-VALACIIGIA--------------------------------------VC
CCLP-----------CIIA-ILYA-------VSDQEGASEDDIRQIPRYKFRRTDEPEKQ
T-ADETGPFG-GIMTECGTNQPIEKVL---APED-AEC----CICLSAYDDGAELRELP-
CGHHFHCACIDKWL-H-INATCPLCKFNIRKSGSSSGS----------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------EEV-----

>gi|115439439|ref|NP_001043999.1|	   304 residues, 50 /line  Os01g0703300 [Oryza sativa (japonica cultivar-group)]
-----MRPPSSS-AT---------------------------------PGTGRV-SAF--
TMRAVAR-MSR---ARWFIFLRR-VYQYQNGPRSDLGSNPFNSPGWLALELGVIMAQMVV
TTAVVATSPKERPA-WPLRVWVAAYNV---------------------------------
-------GNVLSLPLLYWRHR-----HSSSGAR--------GGTLSDDPEMHGAN-----
---------------------DPL--RNRSYLMN-------------KARAFLELFFAMW
FV-----------------MGNVWVFDARLGSF---------HRAPR---LYALCIGLLA
WNAV-----VYSLPFLLFLL--------------------------------------LC
CFVP-----------AVGYALGYNM----NSASVGRGASDEQLAALPQWRFKEPAD----
----------------------APRDR---DHDD-QEC----CICLAQYKEKEEVRQLP-
CTHMFHLKCVDRWL-R-IISSCPLCKQELS------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|115449125|ref|NP_001048342.1|	   342 residues, 50 /line  Os02g0787500 [Oryza sativa (japonica cultivar-group)]
----ICNQSAST-CF--AGTI---------------------------------------
--------------SSWCTYVRRHRSPL-------------NSGLWISIEVLVNVSQIVA
AIVVLSLSRKEHPQ-APLFEWVIGYTV---------------------------------
-------GCFATLPHLYWRYI-----HRNIVNG----------ENEPAHTLQGSSQNNST
EPSASASERRRNA---ARNAVLAN--PRINALFD-------------HFKMALDCFFAVW
FV-----------------VGNVWIF-GGRSSA---------ADAPN---LYRLCIVFLT
FSCI-----GYAMPFILCAM--------------------------------------IC
CCLP-----------CIIS-VMGFR----EDTNNTRGATSESINSLPTYKFKTKKRRHSS
GN--EAEGQ---DGGIVAAGTDKERSL---SAED-AVC----CICLAKYAHNDELRELP-
CTHCFHKECVDKWL-K-INALCPLCKSEIASSSGTSDT----RRSDH-------------
------------------------------------------------------------
----------------TDIPVQ--------------------------------------
--------------------------------------------------EIEMH-----

>gi|115452763|ref|NP_001049982.1|	   320 residues, 50 /line  Os03g0324900 [Oryza sativa (japonica cultivar-group)]
---MEEEPSATC------------------------------------------------
--------------RYFCHMCSLIVRPE-----MGIE---EVKCPHC-------------
-----------------------HSGFVEEMVGGDDDDGRRSGNAAAGGRGAASEENADD
EATPAP-PPWAPMLIDLLGVS-----SRRH------------------------------
-----------------GLDDGSS--DLAAFAR--------------RQYRNIAFLQLLS
AL--------------QDDDEAGGDTPGD-------------------------------
------------------------SGRERLVLVTPADGNGAAATSGFTLGDLFLGPGLDL
LLDY------------LAD-T----D---PNRQGTPPARKEAVAALPTVRVH--------
------------------------------DAAG-ATC----PVCLDEFEAGGEAREMP-
CKHRFHDGCILPWL-E-AHSSCPVCRYQLPTDDEPTAG----NVVVAAEGGDELIGN---
------------------------------------------------------ARGGGG
DGDGDGGSSG------------RRR-WLSWPFGGLFS-----------------------
-------------------------HRSSRRSSSS-------------------------

>gi|115453039|ref|NP_001050120.1|	   283 residues, 50 /line  Os03g0351800 [Oryza sativa (japonica cultivar-group)]
------MSGGRQ------------------------------------------------
--------------SYWCYQCRQRVRPR------GQD----MECPYC-------------
-----------------------DSGFVSEMDDVD------------ALMRHFVGMDPDF
HRDPR-FGIMEAISAVMRHGM-----AG--------------------------------
------------T---NREVDVRG--RPNIFSDL-------------EMEFGSGPWLLFR
GQ--------------LPGHLS--------------------------------------
------------------------EDNGFDVFING--R-RGVGMRRANIADYFVGPGLDD
LIEQ------------LTQ-N----D-----RRGPPPATQSSIDAMPTVKITQR------
-----------------------------HLSGD-SHC----PVCKDKFELGSEAREMP-
CKHLYHSDCIVPWL-E-QHNSCPVCRYELPPQSSTGAS----CSRTRSTNQSQ-------
--------SSSSNGR--TNGRQR-------------------------------------
-----RRNPF----------------SFLWPFRSSSS-----------------------
-------------------------SS---------------------------R-----

>gi|125535735|gb|EAY82223.1|	   292 residues, 50 /line  hypothetical protein OsI_036182 [Oryza sativa (indica cultivar-group)]
------MAAVAG-DR--RDNG---------------------------------------
--------------GGWARRRRRRRRRRGTDAT---------------------------
-------------------AAAAAAGDSDSVGEGRA------------------------
----------------------------RRQRRMGATAAAEEEATGDGRGGGGGRRRRQG
ERRLRQGGVCCCR---RSMEVDAS--AVARALPR-----------------------DFP
PIENLSFEGFPRYTFK------------------------------IGNRIHCTNLMYRP
-----------------GSRTLLTQEEAHEIIREGLRS-DIRR-GRIQLNADFLQQLVDQ
VRDHILQRQRRGTATAMDG-VVEVEDAYRNGGFGAIPASSKAMAELQEAM----------
----------------------------ASDARE-RGC----AVCLEDFEAGEKLRRMP-
CSHCFHATCILDWL-R-LSHRCPLCRFPMPTQDQSY------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|125548509|gb|EAY94331.1|	   324 residues, 50 /line  hypothetical protein OsI_015564 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
--------MGT---RELLVVLAVVVMAAV-------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------GAGAQSSSASPAPATS-----------
------------------------------------------------------------
------------------------------------------------------------
--------------------------QAPTVRQQTPFGRTMSTVITVSIS----------
---------------------VVKHKI---GKSV-LEC----AVCLTSFDDGDDLRLLPH
CSHAFHPECIDPWL-E-SRVTCPLCRANLEKPPPPPPLPAAAAASPSPERSPRCQPSPPP
PPPPHALVIPVEDEEDDSDEDDRKEEAVELEMLRSERRAARLPRSHSTGHSLVASAAAAA
ESGDHERFTLRLPQHVRDEVLRSLRLRHAASLVNLSDMSSEGSSRGGRRALGLAFGNGGG
SSHGGRR-WQAFLAR--TVSWARGGGDGSVRRGWDGSTRRGKDDAESSRKGATSPAAGRP

>gi|125552791|gb|EAY98500.1|	   323 residues, 50 /line  hypothetical protein OsI_019733 [Oryza sativa (indica cultivar-group)]
-----MAEAAIT------------------------------------------------
--------------RYWCHECEQAIEEA-----MVDE----IKCPSC-------------
-----------------------GGGFIEEMTDEEIERL------------TNRQPEPG-
------FSQWNPI----------------------------------EHPGETMDSDDE-
------------------DNDLGR--EFEGFIRR--------------HRRASTLRRVLD
SI--------------HDDLANDQERDSS------------------------------I
LINAFNQ-------------ALALQGSVLDPDEGQGDQ-GGSTNDDGLLEEYVLGAGLSL
LLQH------------LAE-S----D---PSRNGTPPAKKEAVEALPTVK----------
------------------------------IEEV-VSC----SVCLDDLEVGSQAKQMP-
CEHKFHSSCILPWL-E-LHSSCPVCRFELPSEETKDLN----EPSNIGRVED--------
------------------------SHEE-----------------------------VRA
DGPGNVSES-SN----------RPWAIVPW-LNELFS-----------------------
-------------------------TREAQNAGGV------STDQQSPHTSGTNPNAGHS

>gi|15231003|ref|NP_188629.1|	   328 residues, 50 /line  zinc finger (C3HC4-type RING finger) family protein [Arabidopsis thaliana]
-----MSSGVNS-----TGSAAAAPEV---------------------------------
---------DK---MFFCYQCNQTVTISIS---SSAD----PFCPIC-------------
-----------------------NQGFLEEYEDPNPNQS------------LNFNPNSSD
SFFPM-ADPFSTLLPLIFGSS-----AAAP--SGMDFMSLFGPSMQPQARSTQQNPQS--
------------------------------------------------------------
-------DAFDPFTFLQNHLQ---------------------------------------
--------------------TLRSSGTHFEFVIENHPS-DPGNRMPGNFGDYFFGPGLEQ
LIQQ------------LAE-N----D---PNRYGTPPASKSAIDALPTVKVT--------
-----------------------KDML---KSEM-NQC----AVCMDEFEDGSDVKQMP-
CKHVFHQDCLLPWL-E-LHNSCPVCRFELPTDDPDYEN--RS---QGSQGSGDGQGS---
-----------------VEGQQT-------------------------------------
----------PR----------FSI-QLPWPFRRQDG-----------------------
-------------------------SGSGSGAPGT------GGGNLETRGED-LD-----

>gi|15233298|ref|NP_191112.1|	   273 residues, 50 /line  zinc finger (C3HC4-type RING finger) family protein [Arabidopsis thaliana]
-----MSFVFRG-SR--GDLE---------------------------------------
--------SGF---SGGFLPERRAMRVHGARPVNSN-----------------SLAFL-V
TVLLLFMILNSHQMPPNFLLWLVLGV----------------------------------
-------FLMATTLRMYATCQ-----QL--------------------------------
-----QAHAQAQA---AAASGLFS--H---------------------TELRLHVPPSIA
LA--------------------------------------------TRGRLQGLRLQLAL
LDREFDDLD---------------------------------------------------
--YE-----------TLRA-L-------DSDNVSTTSMSEEEINALPVHKYKVLDPENGC
SL--AKQ-ASTSSSAEKMLDSANESK--KGTEDE-LTC----SVCLEQVTVGEIVRTLP-
CLHQFHAGCIDPWL-R-QQGTCPVCKFRAHSGWQEQDE----IDDDAS------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------DMV-----

>gi|18405411|ref|NP_564693.1|	   351 residues, 50 /line  zinc finger (C3HC4-type RING finger) family protein [Arabidopsis thaliana]
-----MEEAVVT------------------------------------------------
--------------RYWCHMCSQTVNPV-----MEAE----IKCPFC-------------
-----------------------QSGFVEEMEDDDDHDSS-----------------DPA
DVRAN-NSLWAPILMELMNDP-----VRRRRNQSV--ESVEDNQNEVQTENNE----D--
----------------DGENDLDW--QLQEILRR-------------RRRHSAAVLQLLQ
GI--------------RAGLSVESESTGNGGN----------------------NPGRVI
LINTSNQ-------------TITV-QN---------SA-DMDSVPAGSLGDYFIGPGFEM
LLQR------------LAE-N----D---PNRYGTPPAKKEAVEALATVK----------
------------------------------IEET-LQC----SVCLDDFEIGTEAKLMP-
CTHKFHSDCLLPWL-E-LHSSCPVCRYQLPADEAK-----TDSVTTTSDNNGSSSAS---
--------ATTSHGAENSDGNRRQEEEE-----------------------------EEE
EEEEEENENNDG----------SGF-SIPWPFSTLFS-----------------------
-------------------------SSQDSNAPT------------------DSS-----

>gi|38454178|gb|AAR20783.1|	   315 residues, 50 /line  At3g13430 [Arabidopsis thaliana]
-----MEDASET------------------------------------------------
--------------SYWCHMCSRSVIPL-----IQDE---IIKCNFC-------------
-----------------------QSGFVEEMDNNDDHQAA--------------------
------DSLWTPILMEMMNNN-----RDQHSTNQEDSESILEDEDEDEDDGDDGDQNN--
----------------DGEIDITH--QLEEIRRI-------------RTRHSTAIVNLLQ
GI--------------RAGLLIESENNEDNPD----------------------NSELVV
LINSFNQ-------------RIRVHQD---------SV-DTTSVPSGSLGDYFIGPGFET
LLQR------------LAE-N----DL--NNRYGTPPATKEAVEALAMVK----------
------------------------------IEDSLLQC----SVCLDDFEIGMEAKEMP-
CKHKFHSDCLLPWL-E-LHSSCPVCRYLLPTGDDDEPK--TDAETSRNDDNNEDISN---
--------ASMASNGSSPD-----------------------------------------
------------------------------------------------------------
----------------------------SSSNNS------------------SVN-----

>gi|18405518|ref|NP_565942.1|	   328 residues, 50 /line  RHC1A (RING-H2 finger C1A); protein binding / zinc ion binding [Arabidopsis thaliana]
-------------MS--SSRN---------------------------------------
--------------THWCHRCQRAVRLH------GQE----PVCFYC-------------
-----------------------GGGFVEELDMA-----Q-------AS---------PF
DMFRS-----------------------------H--RGVVERDQ-----------TFDL
MDAFSVFMRNRLA---ERSHD-------------------------------REIRGRTI
SSGPENFPGLAPLLIFGGQV---------------------------PYRLTGDNAVEA-
--------------------------------LFNGGS-PGIGITRGNTGDYFFGPGLEE
LFEQ------------LSA-G--------TTRRGPPPAPRSAIDALPTIKI---------
----------------------AQRHL---RSSD-SNC----PVCKDEFELGSEAKQMP-
CNHIYHSDCIVPWL-V-QHNSCPVCRQELPSASGPSSS----QNRTTPTRNYRSSSS---
--------SSSS---------------------------------------------NSR
ENGNERRNPF----------------SSFWPFRSSGSSSSSTQNRGGTRNSDTSDENHNY
HQQQH---QQSYMGYS--------------------------------------GWPFDY

>gi|24762826|ref|NP_523864.2|	   286 residues, 50 /line  goliath CG2679-PA, isoform A [Drosophila melanogaster]
------------------------------------------------------------
--------------------------MQLEKMQIKGK----TRNIAAVIT----------
------------------------------------------------------------
------------------------------------------------------------
---------------------YQN--IGQDLSLTLDKGYNVTISIIEGRRGVRTISSL--
--NRTSVLFVSISFIV-------------------------------------LMIISLV
WLIFYYI-----------------------------------------------------
------------------Q-RFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSD-----
----------------------------EKDLDS-DCC----AICIEAYKPTDTIRILP-
CKHEFHKNCIDPWL-I-EHRTCPMCKLDVLKFYGYVVG----DQIYQTPSPQHTAPI---
--------ASIEEVPVIV---------------------------------------VAV
PHGPQPLQPLQA----------SNMSSFAPSHYFQSSRSPSSSVQQQ--LAPLTYQPHPQ
QAASER---------------GRRNSAPATMPH-----------AITASHQVTDV-----

>gi|47207180|emb|CAF92164.1|	   306 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------RRPC
LVPPQVLNAQKAG---YRAAIVHN--VNSDDLISMGSNDGEWPLAPPSSSSSSSSTSSSW
GLMPFLLLSLEVDVMKQIDIPSVFVSEETANSL---KGGYLYDKGGH---LVLMPDFSLP
LE-------YYLIPFLIIVG--------------------------------------IC
LILI-----------VVFM-ITKFVQD--RRRARRSRLHKDQLKKLPIHKYKKGD-----
--------------------------------SY-DVC----AICLDEYEDGDKLRVLP-
CSHAYHSKCVDPWLTK-TKKTCPVCKQKVVPSQGDSDS----DSEEGDSGPDE-------
------------------------------------------------------------
-NEASESTPLLR----------SLASTSAHS-FGTMSAGSRSEHDQESSEYDEELDSSEE
EE--------------------------------E---------EEEVTVETVVVQMQPP

>gi|47230649|emb|CAF99842.1|	   301 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
-------MGKRG-QR--CLLLWLC---------------------------------L--
SGLVRSS-AAF---VFWTAEVEIKY---------------------------WNGVDDKL
VAKIC------------------ECGVFGRNSDV-----T-------EIFGSVVLPTGDL
EGCGSGPLYSHNNSTSWIALV-----K-----------------------------RGNC
TFSEKINAAKRQG---AAGVVVFN--ADGTGNST---------SQMFHPEAVDTVAIMIG
N---------------GQGMGVVRLLRNGTDVEMLIKPGKPHGPWVD---TYWLYLLSIA
FFVVT----AASVTYFIFLSA---------------------------------------
------------------S-RLYRLRRHQRNERRLKSKAKKAIRCLQVRTL---------
--------------------TRDDEEA---NSES-HMC----AVCIESYRMGDVVTVLT-
CDHIFHKTCIEPWL-L-EKRTCPMCKCDILKALGV-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|4884104|emb|CAB43253.1|	   324 residues, 50 /line  hypothetical protein [Homo sapiens]
-----IRATSDH-NA--SMD----------------------------------------
----------------------------FADLPALFG----ATLSQEGLQ---------G
FLVEAHPDNACSPIAPPPPAPVNGSVFIAL------------------------------
------------------------------------------------------LRRFDC
NFDLKVLNAQKAG---YGAAVVHN--VNSNELLN-------------MVWNSEEIQQQIW
I-------------------PSVFIGERSSEYL---------RALFV---YEKGARVLLV
PDNTFPLG-YYLIPFTG------------------------------IVGLLVLAMGAV-
------------------M-IARCIQH--RKRLQRNRLTKEQLKQIPTHDYQK-------
-------------------------------DQY-DVC----AICLDEYEDGDKLRVLP-
CAHAYHSRCVDPWLTQ-TRKTCPICKQPVHRGPGDEDQ--EEETQGQEE-----------
---------GDEG--------------------------------------------EPR
DHPASERTPLLG----------SSP-TLPTS-FGSLAPAPL-------------------
-----------------------VFPGPSTDPP-----------LSPPSSPVILV-----

>gi|51513472|gb|AAH80409.1|	   341 residues, 50 /line  MGC86297 protein [Xenopus laevis]
-----MGSLSHS-RV---------------------------------LGVLSF-LVC--
TFLPVQS-VIY---AYSDASVREPQ--MFDDLPALFG----PSLPIDGMK---------G
SLVEAVPSNACSPI-LPPPSLANGTSF---------------------------------
-------VALIR--------------------------------------------RYDC
NFDTKVLHAQLAG---YRAAIVHN--VGSELLLH-------------MSKNNETLSNHIH
I-------------------PSVFIGQRSSRSL---------LINFS---YYNNSHIYLM
PDYYFSLG-YYLIPFIVVVS--------------------------------------AF
IIIM-----------CIVM-VVRCVQY--RKRMRRNRLSKEQLNKIPIHKFKKGD-----
--------------------------------DY-DVC----AICLEEYEEGDKLRVLP-
CSHAYHSSCVDPWLTK-TKKSCPVCKNRVFRSDSDSDS----DADGNVTN----------
-----------GE--------------------------------------------QGG
ESDDDERTPL----------------LRPAPSFGSMAESPRAQQQEE-------------
--------------------------------------------EEPVAATGVIV-----

>gi|87241012|gb|ABD32870.1|	   296 residues, 50 /line  Zinc finger, RING-type; RINGv [Medicago truncatula]
-----MMIGAGA-YC--ALTRN--------------------------------------
--------------------------------------------PLLLLSRSFN---IFP
KLTPLQFPTTPSPSFPSFNRFPSLFPQ---------------------------------
-------LCIRHSRLSTLPHN-----DSGG----------FGGDSGSGGWDPGDNDSDD-
------------G---GGKW------SFLSCIAK-------------KTEPMNTLVLSAF
LV-----------------FGFSCIVVGGQALV---------EVPFL---LFGLTMVCLS
LNEFFDAVFSFWIYLIVFGA--------------------------------------LF
CIVQ------------IIA-LAYALT---QPLRIREGASEDDIKSLPMYRFCQPNVMIMV
DK--NKT-QLEARTGSHNRSHISELSL---HPDD-SEC----CICLCPYVDGTELYRLP-
CTHHFHCECIGRWL-R-TKATCPLCKFNIRIGDIM-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------V-----

>gi|87241270|gb|ABD33128.1|	   355 residues, 50 /line  Zinc finger, RING-type; Thioredoxin-related [Medicago truncatula]
------MNSETE-TP--SSTT---------------------------------------
--------------SFWCYSCTRFIHIL-----NQNN----VVCPHC-------------
-----------------------QNGFVEEIHA---------------------------
GQSPA-VSLFAD---GIQSSR-----RQTSRRRRR--NAGGSRSPFNPVIVLRGPREDTT
AGVGADAGGGDSE---GN------------------------------------------
----------------TSSFELYYEDSNGTD-----------------------------
-----------------------------------------LRPLPPSMSELLLGSGFDR
LLEQ------------FSQ-IEIN-G---FGRSENPPASKAAIESIPTVEITDS------
-----------------------------EMESE-IHC----AVCKEQFELGSEARKMP-
CNHLYHSDCILPWL-S-MRNSCPVCRHELPSDQNASES----RISGQIDEEA---VG---
--------LTIWR--------------------------------------------LPG
GGFAVGRF-AGG----------RRAGEIQLPIVYTEMDGNNSNEDSR-RISLTVGSNRVR
ERRGIRRIFRNFLSFFGNVNLNRSFS-GSLFRRSS---------RRRSRTWVTEE-----

>gi|92888063|gb|ABE89147.1|	   356 residues, 50 /line  Zinc finger, RING-type [Medicago truncatula]
-----MDETMAA------------------------------------------------
--------------RYWCHACSQIVSPV-----MGME----IKCPLC-------------
-----------------------QSGFIEEMSSA-----T-------GISDLQNTPETDF
GVDRS-PSLWAPILLGMMGNP-----RLRRRLRRI--EL--------EDDYESGNRDDD-
------------H---GGVGHYDR--ELESILRR-------------RRRSSATIQQLLQ
GI--------------RAGLTSESHENTDS-----------------DDRVREREREHVI
LINPFNQ-------------TIIVQGSY----DSNRDQ-SDNHNPIGALGDYFVGPGLDL
LLQH------------LSE-N----D---PNRYGTPPAPKEAVESLPTVK----------
------------------------------INEN-LQC----SVCLDDFEVGSEAKEMP-
CKHRFHSACILPWL-E-LHSSCPVCRSQLRVDEPKQDS----DVS-RNHRNQRDDEI---
--------IGHAN--------------------------------------------ANA
EGDSEGRSPSGG----------RRF-SFPWPFNGLFS-----------------------
-------------------------SSSSSSNANG---------NGTQS---ERN-----

>gi|2982466|emb|CAA18230.1|	   344 residues, 50 /line  putative protein [Arabidopsis thaliana]
-----MVNPVIG-AE---------------------------------------------
-----------------------------------------IKCPFC-------------
-----------------------QSGFVEEMSREINGGSS-------SSLREVQDPEIDF
GTDRA-LSLWGPILLGMMSNP-----RRRRRFRRT--EFGVDNDEVNVSDDVDGNDSVDI
DRHHHRRHRHRQQ---GREIDLDR--EFESILRR-------------RRRSSATILQLLQ
GI--------------RAGIASEYESSDRDLLN---------QSAV--------------
-------------------------VQG----STSLNQ-NRNNTSLSAIGDYFVGSSLDH
LLEH------------LAD-N----D---SIRHGSLPARKEVVDNLPTVK----------
------------------------------ISES-LQC----SICLDDFDKGSEAKEMP-
CKHKFHIRCIVPWL-E-LHSSCPVCRYELPPDDETKVN----PVRPRTRTLEIN------
---------VSNE--------------------------------------------NVE
D--DARNSNVSE----------RRF-SFPWPFSGLFS-----------------------
-------------------------SSSSSSASAS---------GSSHLGEN--S-----

>gi|68565094|sp|P0C041|ATL4H_ARATH	   336 residues, 50 /line  Putative RING-H2 finger protein ATL4H
-----MNTLINV-TQ---------SLINPSRILFF-------------------------
------------------------------------------------------------
---------------------FCLSSFMESDPNPSAWN----------------------
---------------------------------------------------------QYI
N--------------------PRD--CTQGLCST-------------FCPQWCTYINFSP
PP-----------------ISYEQFLN---DGV---------ASNPN---LSPLVI--AI
FGIFATAFL-LAAYYTLVSKYCANDTTN----EAASES-GRSDIILD-----VNSPERGD
QDDP-----------FAL-------------ESSTAGLDDTLIKKIGFFKLKK-------
----------------------HQNGF---KING-TDC----SICLGEFNEDESLRLLPK
CNHTFHVVCIDRWL-K-SHSNCPLCRAKIIVPTTQQPE--HHVVVMNLDRFTSN-VG---
--------SAEGN--------------------------------------------VVV
D--DHREEVSVS----------ISS-HHPSWFSAADIVLRISRDGEE-EEGNYDLENGNR
EK---------------LVDLKRSFSSGGLVLGTQ---------GRTRRSLNICP-----

>gi|92868172|gb|ABE78258.1|	   315 residues, 50 /line  Zinc finger, RING-type; Thioredoxin-related; RINGv [Medicago truncatula]
-----MSLTG---RP--RVIVNGVRRMR--------------------------------
--------TFH---YFWCLNCQRTVRIPSTNTIQNYG----SFCPYCFHQLRYE--LDIS
RPRLLMNDPNNRNIDPPPST----------------------------------------
------NQLMGSLAFILDPSL-----RR--------------QDQNNTTPQWGTEHEDDQ
N-----------------------------------------------------QNPQAW
IT-----------------LRFVRPTRPTRPIA---------PPPPQ-------------
---------------------------------------NMAPQLND-----IETPSLDE
FFDG-----------------VIH-N---NIRPGPPPASPSAIEALPMVKVTETH-----
------------------------------LASD-PNC----PICKDEFEVDVQVRELP-
CKHFYHSDCILPWL-Q-MHNTCPVCRHELQGVDNHNAN----YYFFQNEIEQQGFLG---
--------FEEFT--------------------------------------------SSF
N--WIW------------------------------NQLASIRPIRA-VL----------
-----------------------DWTRSYFELH-----------ARARSRSKIKL-----

>gi|92879543|gb|ABE85587.1|	   266 residues, 50 /line  Zinc finger, RING-type [Medicago truncatula]
-----MSFAFRG-SR--GDIENGFSEYVPERTSMFDC----------DSYAAPF-YLS--
GFVHLGQ-SIA---IVWFFFLQR----------------------WIILSVFVMVTSLRA
YAIYLHLQSQARA-HAAAASGLLGH-----------------------------------
------------------------------------------------------------
------------------------------------------------AELRVHVPPSIA
FA-----------------TGG---------------------------RLQGLRLQLAL
LDRNFNEID-YDTLRVL-------------------------------------------
-------------------------------AFGTPSMSEEEINALPIHKHKVTGPIKDG
ST--GS-TSSSSEAAEIKQDCKGEEGSANDQEDG-LTC----AICLDQVQRGELVRSLP-
CLHQFHASCIDQWL-R-RKRTCPVCKFKMGAGWLSNNA----CESDDS------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------DI--------V-----

>gi|147815560|emb|CAN70531.1|	   305 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----MANQNDG-EH--IIEIGDQRPSIPTIQTPSSS----------P------------
-------------------------------SHSNPF----ESGLWISLQFILSVIQIVA
SIVVLSLSKXNGDXDYKLFSWVVGYAC---------------------------------
-------GCVLMLPLLYCRYI-----VRGTV-----------------------------
-----------------------N--LQLYGIVE-------------VLKMSLSCFFAVW
FV-----------------LGNVWVF-GSSSTG---------KDDTK---LETLCLVFLA
SGCIMYAMP-VX----RCAA--------------------------------------FC
LLLP-----------FLIL-PTLA-S---PQEQAREANPDYSFNALPTYNFKLKENG---
----------TGESGVLAAGTDKERAI---SGED-AVC----CICLGKYADNDEVRELP-
CSHFFHVECVDKWL-K-INPRCPLCQSELGGAGGASTL----VTHSSQ------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------DQSERMTDTAS-----

>gi|146161644|ref|XP_001007660.2|	   306 residues, 50 /line  hypothetical protein TTHERM_00059280 [Tetrahymena thermophila SB210]
-----RKQSSKN-HI---------------------------------IKQRKK-HKQ--
SEKMD-----------------TLDNHNNN----------------QLQQNIDNQIARKM
WCHTCKFEFQTANS-TSFECVKCKNDFCEEIEPQIEQI----------------------
------DDPRQFVPFGEEQNQ-----TNNQQQ----------------------------
----------------------FQ--RNVQNSQQ-------------NNLQNVQYPQQNN
RM-----------------GSASTIRTNINRQG---------QGQGQPTLSYSISIQSTQ
LENPFFGIN-NLISNLFPVT-----------------S-QRTGLFG------MNDNNFDN
IIDF------------LMR-NDPN-------VYGTPPASENSISNLPTVTFSTEQV----
--------------------------K---EETL-CEC----SVCKEEFTEGEQLVKMP-
CNHMYHSSCLVTWL-K-MHNSCPTCRYELPTDNQDYER----RKQQRN------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------NQNQN---RRN-----

>gi|92870577|gb|ABE79861.1|	   297 residues, 50 /line  Zinc finger, RING-type [Medicago truncatula]
---------MEE-RQ---------------------------------QEQQRQ-VIT--
VGTLN-----------------SLLRSENDDDDGACV----YSRAVLVVDMVWNLAFVVV
AAAVILSTFNERPS-TPLRLWLCGYAF---------------------------------
-------ECLLHVAFVFSEFR-----VTTRDS----------------------------
----------------------FS--HTPYSIAK-------------KLEPMNTLASSVW
WV-----------------FGFYWIVVGGQPLL---------EDSPR---LYWLTVVFLA
FDVFFIIFC-IGMACIVFFA--------------------------------------LF
CIIP------------IIA-LAYA-------LRIREGASEDDISSLPMYRFSQSNVMVMV
DD--NKKQHVKAKIGSYNPSHISELSL---HPDD-SEC----CICLCPYVDGTELYRLP-
CTHHFHCACISRWL-R-TKATCPLCKYNIRRADTL-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------V-----

>gi|15220639|ref|NP_176974.1|	   343 residues, 50 /line  zinc finger (C3HC4-type RING finger) family protein [Arabidopsis thaliana]
-----MSSPESP-----SGSDSSTPLLRSRQS-----------------SPRRQ-PVI--
AVLLNRA-SGR---RGASMVVRETAAQELEERRADWG----YSKPVVALDMLWNTAFVLV
AIVMLLVFKEEKPN-VPIRIWICGYAI---------------------------------
-------QCLVHVVLVWLEFR-----KRNARSR------PGDLEAAQATNQDSE------
D--------------------EDN--DERFLSTK-------------TCESMNTIISFVW
WI-----------------VGFYWLVSGGDILL---------QNATH---LYWLTFVFLA
FDVFFAIFC-VVLACLIGIA--------------------------------------LC
CCLP-----------CIIA-LLYA-------VAGQEGASEADLSILPKYRFHTMNNDEKQ
SD--GGGKMIPV--DAASENLGNERVL---LPED-ADC----CICLSSYEDGAELVSLP-
CNHHFHSTCIVKWL-K-MNATCPLCKFNILKGNEQE------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|92891213|gb|ABE90731.1|	   336 residues, 50 /line  Zinc finger, RING-type; RINGv [Medicago truncatula]
-----MSTP----------NYAHAPLLRPRRVG-------------------RT-PVL--
ALLLG-----R---RGPSVLVRETAARELEERRADWG----YSKPVVLLDVTWNTVFVVV
AAVMLGCSVDENPN-TPIRLWIFGYAV---------------------------------
-------QCLVHVALVLLEYR-----RRNVIGG------GRERDEESLDDVNDSEEDDDV
E--------------------FLN--SSSSGFAK-------------RCSSLNTMLSLLW
WM-----------------VGFYWVVNGGDILI---------QDAPR---LYWLAVVFLA
FDVFFAVFC-VALACLIGIA--------------------------------------LC
CCLP-----------CIIG-ILYA-------VAGQEGASESDLSTLPKYRFQVPGNEETP
SP--KGGSMV----PIENSSGANERVL---SPED-AEC----CICISPYEDEAELHALP-
CNHHFHSTCIVKWL-K-MNATCPLCKFNILKGNEQV------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|119621879|gb|EAX01474.1|	   262 residues, 50 /line  ring finger protein 165, isoform CRA_a [Homo sapiens]
-----MAPAHQH------------------------------------------------
--------------SGALHQSLTPLPTL-----QFQDVTGPS-------FLPQALHQQYL
LQQQLLEAQHRRLVSHP-----------RRSQERV-------------------------
-------SVHPHRLHPSFDF----GQLQTPQPRYLA-EGTDWD-LSVDAGLSPAQFQVRP
IPQHYQHYLATPR-------------------------------MHHFPRNSSSTQMVVH
EIR---------------------------------------------------------
---------NYPYPQLHFLA-----------------------LQLLQLEDRLGN-----
---------------------------------VTRGAVQNTIERFTF------------
------PHKYKKRRPQDGKGKKDEGEE---SDTD-EKC----TICLSMLEDGEDVRRLP-
CMHLFHQLCVDQWL-A-MSKKCPICRVDIETQLGAD------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------S-----

>gi|147812656|emb|CAN68374.1|	   306 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----MRDNPTIT-----THDVNLH-----------------------------------
--------------STSGHAEIESMETR-----LADRRIGPREPVERNVRFSRTLSVGRL
RDRVLRRSSFSDLTFCP-----------LRREREARDMSQVCLAPCLAAKILKM------
----ETSRSRDARYHDLLEHR---SNFLERRRRIRS-QVRALQRLGSRFENLSGHERSCI
LSGQHRTGRCTCR-------------------------------V--NTRDANSNDDTSA
RAS---------------------------------------------------------
---------ISR---IVMLA-----------------------EALFEVLDEIHQ-----
-----------------------------QSVVLSSRPSVSSIGSVP-------------
------APNEVVESLPLKLYDKSQKHQ---NDEA-AQC----YICLVEYEEGDNMRVLP-
CHHEFHRTCVDKWL-KEIHRVCPLCRGDICRSVQQSIG----------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------GTEXL-----

>gi|145359146|ref|NP_200027.2|	   280 residues, 50 /line  protein binding / zinc ion binding [Arabidopsis thaliana]
-----MSRLVNQS-----SVDENI------------------------------------
----------------AVYLQNELSELT-----VNDYAIGR-----EIQQQYQNKSICND
AAIALEIQKEEEACVHSCLH-DDE-GLARTLQDLEANLQPSLSDDEKLARYLQEHDELAN
NTEDDIQETHHHQYHPMQVNR---SYI--------------------PQRDAPSSSRAIF
HYDDGENFSGRYT-------------------------------HTHSPS--SISHNPTD
DEN---------------------------------------------------------
---------NDPENM---TY-----------------------EELTELGDSVGD-----
---------------------------------VGKGLSQERISRLRT------------
-------HKYGTKTKSWYCLH-MKKKF---VADD-SQC----SICLMEYAKGDKITTLP-
CKHIYHKDCISQWL-K-QNKVCCICKAEVYP-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------

>gi|92898078|gb|ABE94043.1|	   305 residues, 50 /line  Zinc finger, RING-type [Medicago truncatula]
-----MEENLLSKNFPMQVKEFGWM-----------------------------------
--------------ILMVVHQDGSLNID-----LNNDSPFQWDRFDHSTHYYENVTFLNC
TTNFANGPMFDDLPNIPCLS-NDKYSIMYTLQSPLSNL----------------WSPSCH
EIRSAKVPVINKSGLPTVIHD---GLYSDILLRWNTPLCSCKEDQFCGFAKGTGYDVTC-
----YSYFDNPGG-------------------------------NPTTPKNKTICFFLIW
GLT---------------------------------------------------------
---------GILLFMWVTLS-----------------------L----CKDRQQN-----
-----------------------------HTQQTQTITNIEPSNQEPHWFVFG-------
------LDHSRIEQYPKIQLAESGQLP---KSID-NVC----SICLSEYKPMETLRSIPQ
CNHHFHADCIDVWL-K-MNATCPLCKN-LPE-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------



Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.