At2g01650.1/Structure

&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g01650_1wj4_A.pir.txt

======================================================

Assigned types to 458 residues in Sequence 2-01650, 0 remain unknown
Assigned types to 116 residues in Sequence 1wj4_A, 342 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file At2g01650_1wj4_A.pir.txt into sequence alignment.

======================================================

>1WJ4.pdb  Made from 1880 ATOM records in 1WJ4.pdb
GSSGSSGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRY
PDGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYD
ITLQEAGLCPQETVFVQESGPSSG

======================================================

Best alignment:
1WJ4.pdb    43  KAQLMLRYPDGKREQITLPEQAKLLALVKHVQSK-GYPNERFELL    86
                ++ + +++PDG   Q          AL + V S    P+ +FELL
2-01650    353  RSMIRVQFPDGVVLQGVFAPWEPTFALYEFVSSALKEPSLQFELL   397

======================================================

Highlighted IDENTICAL residue PRO   51  index1   51  path  361  %Seq 100.00
Highlighted IDENTICAL residue ASP   52  index1   52  path  362  %Seq 100.00
Highlighted IDENTICAL residue GLY   53  index1   53  path  363  %Seq 100.00
Highlighted IDENTICAL residue GLN   57  index1   57  path  367  %Seq 100.00
Highlighted IDENTICAL residue ALA   68  index1   68  path  378  %Seq 100.00
Highlighted IDENTICAL residue LEU   69  index1   69  path  379  %Seq 100.00
Highlighted IDENTICAL residue VAL   73  index1   73  path  383  %Seq 100.00
Highlighted IDENTICAL residue SER   75  index1   75  path  385  %Seq 100.00
Highlighted IDENTICAL residue PRO   79  index1   79  path  390  %Seq 100.00
Highlighted IDENTICAL residue PHE   83  index1   83  path  394  %Seq 100.00
Highlighted IDENTICAL residue GLU   84  index1   84  path  395  %Seq 100.00
Highlighted IDENTICAL residue LEU   85  index1   85  path  396  %Seq 100.00
Highlighted IDENTICAL residue LEU   86  index1   86  path  397  %Seq 100.00
Highlighted 13 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g01650_1wj4_A.pir.txt.1WJ4.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g01650_1wj4_A.pir.txt PIR amino_acid 1WJ4.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@