Fandom

Proteins Wiki

At2g01650.1/MSA

< At2g01650.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|18379271|ref|NP_565271.1|	   458 residues, 50 /line  PUX2 (PLANT UBX DOMAIN-CONTAINING PROTEIN 2); nucleic acid binding / zinc ion binding [Arabidopsis thaliana]
--------MDDVKDKLK---G-------FM-----KKVN---------------------
------------------------------------------------------------
--------LSSSSGK--FKGQGRVLGSSSSSSAPP-VNPIQNRFNSSQAPNPTPRPKPNP
NPLPEKPLS-SSDQKISGSTRNPD------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------HDP------------------VRAPQDGFDP
YGA----------------FITSSNRS------QNGYSLSMFECPICKNP-FTSEEEVSV
H--VESCLGD---T----NGDESSFEKDNNDNDK--------------------------
-----------------------SEMEKLVVV--YLSGKPSESSIDVLLRLFK-------
---------------------NIVKEPENAKFRKVRMSN-AKIKEAIGDVAGGVELLELV
GFELKEENDEIWAVMD--------------------------------------------
---V---------------PSEEQSILINKVVGYLE-------K---RKTESSGS-----
----------------------------------------------------------SA
QVMEP----VAPKK-IDRE------------IRVFFSVSE-------NVASRIEV---PD
SFYSLSADEIK-------READLRRKKIA---ESQLLI---PRSYKEKQA------KAAR
KRYKRS-MIRVQFPDGVVLQGVFAPWEPTFALYEFVSSALKE--PS--LQFELLDPVLVK
RRVIPH----TPAPGQKPITLEDEELVPSALIRFRPIET-----DSL-------------
------------------------------------------------------------
-------------------------------------------------VFTGLRNELLE
ISEPLS------------
>gi|108871143|gb|EAT35368.1|	   509 residues, 50 /line  conserved hypothetical protein [Aedes aegypti]
-------MASKTVTVLTVHGR-------RQ-----NVKVDPNTTML--------------
--DVLEQVCRKF---SFEPSEYDLKH------------HNKVVD-LSAMFRFSGLPNNVL
LEMVPATKVRT-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------EADILLVL
Q--LEDGTR---LD----GTFKPSTTLLAVL-----------------------------
----------------------------------------------ETLCKEK-------
-------------------------AKAESNPVMIYMRR---------EVLW-DSLDKTT
LKSLGLTGGRAIIRLLQRKPEELKTQANVSAPLPQKEKSEEDDIAPSRKASS--------
-------PKKDVEKEPTPTSSAPYKEQDPHVLAKTSKDDLCVRPG-PSKTESKSQPEMP-
----------------------------------------------------------VV
KDSQPMPASEIHIL-GERD------------AVLFNLET--------AEHGSCEL---PD
SFYDVTVKDVRIM----YTDLRHKVKELE---EQPLM----TFELRKLEDE--KRVLNNL
ARYRNT-IIRVQFPDRYVLQGIFKLHETIADVIAFSQAHLED--QF--AAIHLYTTPPKT
IL-------------SPELTLVEAKCVPQAILHVGFENDLK---PDKPL--------KSN
L-YEQL---SNATGATELAARSRKNIPDG-FGTTTSSSATSMETDPPIDEDTG-------
----------------------------------EASGAWRNTNRIPNQNFRPSSVQSAT
TSDVKLPKWF-KMG---K
>gi|111067869|gb|EAT88989.1|	   538 residues, 50 /line  hypothetical protein SNOG_03784 [Phaeosphaeria nodorum SN15]
---------MSHVLVFNSHAK-------TV-----KIPTTPIKYLT--------------
--EVRDEACQKF---GVSKDQFTLKF------------NNKPIS-LSQQIRFANLVPGAR
LELVQASRSPTVISV---------------------------------------------
---------ALQLPASE----KNARLTQKFASNTSLWEILRQFESGQ-------DANYNF
TQRGVPQMSGA---SGAGRLHYEQPVITVMPGHREQANFTGLQQTLAQLGFDSGSALLKL
SY----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------KNSGLPLEEAMAQISQYFK-------
---------------------SDQPADTSAEGAHAATST-QAVSQPILEQAAPEATTTVA
GETIRSEEPD--------------------------------PQPMDVEEEATDLPSTEP
-----------------------DVPMEGATVDNVGDMSPAATQA--AATSSASDAPS--
----------------------------------------------------------ST
SVAAP-----ETTD-QPRN------------VQIFSAPTS-----STPQAARKAF---NE
SDYLPTIEHAKVH-------QAQLLNKTR---NTRLLS---DKELEEQEKA--RQEKLAA
AAAKGG-ALRIRFPDGTLVQMNFTKDDTATALYDFVQGFLDR--KN--EPFELKNTGPTG
RL--------VLIQKDGKRLSHDLRFSTNELITFQWAES-----ASAEARA-SRKTLAQE
W-QAKATELKVEEPQA--------------------------------------------
------------------------------------EKSQPPSQGQTVAEGKRKAAMSSE
DKESKLKSMLGKTLFKRK
>gi|115398101|ref|XP_001214642.1|	   510 residues, 50 /line  conserved hypothetical protein [Aspergillus terreus NIH2624]
--------MSSHVVVLDSTAR-------RA-----TIKTTPGKYLT--------------
--DVLQEACKKL---GVDPNQHGLKY------------KGKQLD-LSLAFRLSGLSSGAK
LELVQLSRSPSVVTV---------------------------------------------
---------ALQLPESEARGVPNGRLMDKFPSTTTIWLLLRKFEAGVAGT----SSTRNL
TGRGVPVTGT--NNEAAGRLYYETPVVQIL--DRELSTFDDLQKSLAQLGFNSGNVLLRL
SF----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------RRTDEPLEEAMVKIQEYF--------
----------------------------------------KSSEDAAPESSQPAAELEKT
AIEPSQNEQQ--------------------------------------------------
------------------------------------------------------TPSSTS
DETPNADISTEQPSELPKSPPSAPSEPIE-------------------------------
-----------------------SPTAASRSITVFAPPSN-----DTPQSAQTAY---NE
TDYVPSVDHAKAH-------QRRLNQASQ---NKRLLS-DAEIAKKAAAE------EERL
AGIKEV-DVKVRLPDQSQIVAKFGQEDTGKSLYDFVRSCLAE--PFAREKFSITHFPTGG
PGSSSKRMLNVVPDSDQSLLIKDLGLAGRVLVNFSWNED-----TSLAARESRSGLLRQE
L-RTQAQEIKVEQPPD--------------------------------------------
------------------------------------VMDTSPDTTQAKPESSRQGEKSGA
RKSGALPKWL-KLP-GKK
>gi|115636696|ref|XP_001190437.1|	   438 residues, 50 /line  PREDICTED: similar to UBX domain containing 1 [Strongylocentrotus purpuratus]
--MKK---IGAFFEKKKTDMK---------------------------------------
------------------------------------------------------------
-------------FK--QAGHGVKLNESTPQSSTS---------------GQPRPVAPRL
EPSCSSQMA-GQAALTRLDPGPGAC-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------RPRSAASASIKAQVQLDNEAKQK--QLSSQA
QGGA---------------TANQDYSDNQA---ALLVLGVTFRCRCSM---RLKKPEFEA
H--LTECLLMQL----------------AEDPPS--------------------------
-----------------------ASATMVYTL--NKDKGKIKVGVDTICKYLD-------
---------------------NVCLNPGEEKYRKIRSSN-KAFQERITGLVGAEEFLQAV
GFERKI----LPYED---------------------------------------------
-------------------SETDFFVLNEERASDID------------RLNAMKE-----
----------------------------------------------------------LL
KSGTP-----YKPV-LERD------------MKVYQPS---------QRASHFEL---PS
EFYMLTPEEIK-------KEQQIRAEVIE---RGSVLR---TKAMKEAES------QKAL
RRYRYA-LIRVRFPDGVLLQGTFYARDKLRTLKEFVQSQLDN--SW--QPFILTDPGNIK
LT-------------DDDKMLAELHLAPAVVINFSWDAE-----VMADI--------AAA
NQGAMR---VTY------------------------------------------------
-----------------------------------------------------LKPDAMG
QLQP-------------L
>gi|116058538|emb|CAL53727.1|	   446 residues, 50 /line  Predicted ubiquitin regulatory protein (ISS) [Ostreococcus tauri]
--------MDPLTVRCNQYTTTHHGHGPRARRRAPRTRRPPGSHSRGLFRTNRRRAAKTA
IERPMRVKCGECGETFDDLDAAKTHGAATGH--------------ENFHGDEDSLMEDAH
EN-----------------------------------GPASEQSGAATATTTADEGPR--
---------------------------------------------------------MIE
PRVREDLLKELTELMGFGRNKAIRALHFSK--AD-SSERAIDWIERHEDDPDVNEPLLVP
DEAHE-------------------------------------------------------
------------------------------------------------------------
--------GAKAKTVSKLTPEEARAKADELRRNAAARRAAEEKESERLRE-QERIR----
-------AGKELVEAKRMEDELSLKRNAEQRAAEKEEMERARAKIRAKIDEDRKERRRKL
GLP-----------------------------------EELSPEELEQEREREEKRAKEM
MEEVERKAKAGMYVKPVSKLENLRRHLVDIKKAFAEDADAVTTCFNTLLTYLG-------
---------------------NIARAPNEEKYRSIRLSN-AAFQKRVVAVGGEI-YLLEF
GFKEIVD-----------------------------------------------------
------------------DAGEKRLVLPQESVDQVL------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------LKTA
G-EELH---GAI------------------------------------------------
------------------------------------------------------------
----NNPFFG-M-----L
>gi|116181894|ref|XP_001220796.1|	   552 residues, 50 /line  hypothetical protein CHGG_01575 [Chaetomium globosum CBS 148.51]
--------MSTHVEVVSTDFR-------RA-----KVKVSPGTYLV--------------
--DVLGEACKKL---NLKSDKYELKH------------KQKLVD-LTGPFRTSGLGPGAK
LELVQKSKSASVVSI---------------------------------------------
----------------ALDV-NGQRYTKKLPSDMSLWKVMRQFET--------SEKGLSI
TGRGVL------VGTNSGQLYHDAPVVNIM--GREYAAMEDLQKTLSQCGINSGSMVL--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------RVTF--KLGERTLYDAMQEIAQYLD-------
---------------------EV--EPEQSKSKEGAESHPALVTEELKADEGTPG-----
------------------------------------------------------------
-----------EVAQPEAA---------------------------------------AS
AATPASTEEAALSVPAESRTAGEPME------------------------------VDGP
SAAAP------------------SPSNPIQPTGVFAAPTS-----STPAAAHTHE---DD
SVYEPTIAHAQLR----QHQLLQRAQNT----RLKSDA---ELAAEAAEE------AARL
AKVTKV-EIKVRFPDQTSAVWTITPVETGAFLYQAIRNIMNH--PA--APFKLILPGPKT
VI-----------QESGKALVAQYRLKGREMLHLLWEDS-----VAANV--RQEPFLKGS
V-ASKATEVVVPDI---------------PEGVADERDEAGPSTA----QPARQEKGKGG
GGLDSDAMKKKLGRQHDWTFHYGQIPRDLVSVVISAIDGTSTARTPIHAQTPDSLGHEGA
QGPLCRDCPI-VI--VVS
>gi|118787983|ref|XP_316424.3|	   439 residues, 50 /line  ENSANGP00000020442 [Anopheles gambiae str. PEST]
MAPSK---IKNFFLRKKAEAK---------------------------------------
------------------------------------------------------------
-------------LKLGVAGPGRKLNSDAPPP--------PSSKASSSKQKDAYVPPKRN
ELSAEAKAA-ANAALARFEGKDK-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------KEFNTSLAAIRAQVRKELEAEKKAKEGGGPT
EQEGS--------------AEDGTAQEARK---DYAVQGVFFRCPMIGDE-ILPYKEWKG
R--IKEFLYEQL----------------AADRGL--------------------------
-----------------------TACLIIYNC--N-PKDKAEVCIETLSKCIE-------
---------------------NIINNPTEEKYKKIRMTN-RMFCDKIKVCEGSLDFLHAA
GFAEIELD----------------------------------------------------
--------------------GEPHLIWSEDNIDPEC------------SLEVLLE-----
----------------------------------------------------------AL
KAAEP-----IPVE-LDRN------------LQVLLPS----------QVKRSNL---PP
DFFRISPEEIK-------REQQLRTEALE---QAQILK---TKAMREKEE------LRTI
NRYKFS-LIRVRFPNGVYLQGTFNVYEKFGQVCEFVQSCLMH--ES--ADFALVSPGGLK
YD----------DPDDLDRSLYDLRLVPTVVFNFCYENESK-------------------
----SL---TDF------------------------------------------------
-----------------------------------------------------LKEELML
LIQS-------------F
>gi|119113798|ref|XP_310708.3|	   420 residues, 50 /line  ENSANGP00000022051 [Anopheles gambiae str. PEST]
---------MATVTVLTVHGR-------RQ-----TVKVEPNMTIL--------------
--EILETVCRKY---NFPQDEYDLLH------------HNKVLD-LSTMYRFAGIPNNAL
LEMAKAKRARV-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------EDDVVVQL
Q--LEDGTR---TA---NGTFKPSQSLLDVL-----------------------------
----------------------------------------------VALCPAR-------
-------------------------ATAESHPVLVYMRR---------EVYW-GQLPATT
LKSLGLTRGRAALRLLQRRAEEPKQQANVSAPLPPVVPARNDAKPPTTTVTTSAVPSATG
------SSELPNVAKPT----------IDPAEEKPVSVVPQAEPIEAE------------
--GKAEPAEKKVAVERPDEPKAGEQAVE------------------------------EA
VPERPRPEARIVVL-GDRD------------AVLFHAST--------AERDQTEV---AD
SFFDLTVPEMMQL----YKQLQERVKSLE---DAPLL----TGELRELERN--QQLLSSM
GRYRQA-VIRVQFPDRHILQGVFQVYETVGHVVEFVRGYLAD--PN--QSFCLYTTPPKV
VL-------------QPTASLLDAGCFPQVLLHF--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------
>gi|125539574|gb|EAY85969.1|	   414 residues, 50 /line  hypothetical protein OsI_007202 [Oryza sativa (indica cultivar-group)]
-MAGLSLRCGDCGVLLRSVEEAQAHAEA---------TNHANFSES--------------
TEAVLNLVCAACGKPCRSQTEVDLHTKRTGH--------------TEFTDKTMEAAKPID
LEAAPPKPAGKAM-----------------------------DVDASASAEPQEMVAPEV
N-----------------------------------------------------------
----KEMLADL-EAMGFTTARATRALHFSG--NS-TIEGAINWLSEHQEDPDIDEPLLVP
ANTIT-------------------------------------------------------
------------------------------------------------------------
--------EA---NKPSLSPEEMKIKAQELRERARKKKEEEERRMERERE-KERIR----
-------IGKELLEAKRIEEDNERKRMIELRRLEKEEEKRAREKIRQKLEE---------
--------------------------------------DKAERRRKLGLPPEDPAAPKPS
APPPVEEKKSALPVRPATKAERMRDCLRNLKQQNKDDDAKVKRAFQTLLTYIG-------
---------------------NVAKNPDEEKFRKIRLSN-ATFQERVGNLHGGIEFLQLC
GFEKLEG-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------NEFLFLARDKVDKAVL-------------------------NTA
G-AELN---SAI------------------------------------------------
------------------------------------------------------------
----TNPFFG-V-----L
>gi|125562271|gb|EAZ07719.1|	   394 residues, 50 /line  hypothetical protein OsI_028951 [Oryza sativa (indica cultivar-group)]
------MATPQLDKRILSELELMGFPTARS-----IRALHFSGNSS--------------
LESAINWLLEHE----NDPDIDQLPL----------------------------IPREIN
IECGDTPN----------------------------------------------------
---------------EARNDIQGMRHGCFIGLMPRRVNQKSQQQLE---------DRRSK
TCKVHHVEATL-IGKPVL-------------------YTFINCCHTSHLNF--LYQETSQ
VERE--------------------------------------------------------
------------------------------------------------------------
--------LN---ADQNEDEVRRRIIELFKSKQDGQERERGRIQNQLQEDKRERIR----
-------AAKDLMEAKRTLEENQRKR----------------------------------
--------------FVSYATCRKKAKAWFANGKPSSFSPNLNSNEGLKFPEHLYFSCDLE
TTFLTFLAPQIKPVEPAVSPEQLRDCLRNLKKNYKDDTTKVTRAFQILLKIIA-------
---------------------NIVKNPEEEKFRRIRLNN-PVFKERVGNLQGGVEFLELC
GFMKLAI-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------SGYLVMPRDNINLALL--------------------NAA
G-VEVA---SAM------------------------------------------------
-------------------------------------------------------ENPYF
GL-------------LSK
>gi|125807506|ref|XP_001360421.1|	   447 residues, 50 /line  GA18903-PA [Drosophila pseudoobscura]
--MSK---IKKFFSKKKEEAA-------AF-----KVKLM--------------------
------------------------------------------------------------
-------------GS--SMGEGHKLNTPKPDAPSS--------SNSRGRKYEAYVPPKRN
ELSNEARAA-ANAALSRIDKKTS-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------REFNTSLSAVKAQAKRELEAERRQKEEASAN
VEV----------------SASTVSTLSGGDNRNLACEGVFFRCPMVSDE-ILPKKDWKV
K--IKEFLYQQLE---------------EGDRGL--------------------------
-----------------------TACLIIHNC--NV-KEKADDCIATLVRYLE-------
---------------------NLITNPTDEKFLKIRMSN-KIFSEKVRYVEGALDVLHAA
GFSEVQID----------------------------------------------------
--------------------DEPFLLWTREQTEQDL------------DLPTLVD-----
----------------------------------------------------------GL
KNSEC-----IPLE-LDRN------------LKVLLPS----------QARRVVL---PN
DFYRLAPEEIK-------KEQQLRSDAIQ---QAQMLR---TKAMREREE------QRTL
RMYRYA-LVRVKFPNGLVIQGTFNVYEKISDIFEFVQSCLAD--ES--LEFNLVATSEGK
F-----------GEEDMDKTLFDCKLIPNSLLLFCPETS-----SSD-------------
G-NAGD---VNY------------------------------------------------
-----------------------------------------------------LKEELFM
LVQS-------------M
>gi|145495214|ref|XP_001433600.1|	   406 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
-MQQK--SSTYVRQALTQIAFE-------M-----GKPISLVEPYI--------------
--EILE-------ENWYETKEQIKMMKQENFDEFKIPKRIGQLL-MEFVQRADDMKQNWQ
LELTKIISE---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------ISDQDQLFKTLEIIFKIIS-------
---------------------NVIMSPLSQDKQKINICS-KTLQNNILKYPSALNYLSKL
GWKIEAEF-------------------------------------LLVEYKMDNQNDWKE
AVEELV---------------------------------------NYTQKKSGFNPQKPS
VHTSS--------------------------QNVSITSELAKSEGYDVYSFSQ-----KL
EQLHQRRFEIMNQPITNRE------------IKVFIGRKQQ---SPVQLQQQIQG---QE
DYEEVQPQKDQQL----LKFLQQVAQ---SLEEQQFA----SKRKKEYEE------LLNK
PIFCKT-DIRVQFPNSMIVQAIFGPLETLQALYDLIKDMLVN--SN--LEFYLYTSPPPL
RM----------TQKYLKQTFDDLSSVPNGLFYFGVEKQTS------------EFYLKE-
------------------------------------------------------------
------------------------------------------------------------
-------EWM-KQA-KEL
>gi|145603037|ref|XP_362107.2|	   515 residues, 50 /line  hypothetical protein MGG_04552 [Magnaporthe grisea 70-15]
--------MSSNVVVISTDFR-------RA-----TVKVSPGTYLI--------------
--DVLDEACRKL---NLQSDKYLLKH------------NNKQLD-LSNQLRAYNISHGAK
LELVVRSNTTSVVSV---------------------------------------------
---------ALKLPDSEAAGIPNGRLIEKFRSDTTLWKMIRHFESGASTSGVASGRKFNF
TARGVPQTAGG-SQAGAGQLYHEGPVLNVM--GRELSSLADLQKTLAQVGIMGNVLITLS
F-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------KLSGMTLHEAMQQIEQFFT-------
---------------------EDSQAPAAASSDKPKAEE-PAVTTQASSQENTPQPL---
----------------------------------------ISTTSTPESQDVSTNNNQSM
SQAEASTSAGQGTSQPD-------------------------------------------
------------------------------------------------------------
--------EAQSSS-TGRG------------MQVFAAPSA-----STPAAALTKD---PE
SAFQPTIMHAQLH----QQR--LQQNSVNK--RLPSDR---EIEAKQQAE------AAKL
ASIKEV-SIKVRFPDNTSAQWTFGPEDTSGSLYDEVRKVMAD--PT--QPFKLVSPAAKG
PGGTGDL---IDGSGEKHNLIRAYRLEGRVIATVVWADA-----VPPSV--RKAPFLKGS
V-AQQAQQIQVPVIPV--------------------------------------------
--------------------------------------STPDTEDVPMPTPAGRSEKKGD
GSGVKLPKWL-KLP-GKK
>gi|146103574|ref|XP_001469593.1|	   368 residues, 50 /line  hypothetical protein [Leishmania infantum]
-MSSD----------------------CKE-----TESPQAGEPLA--------------
A----VKLPSVNSSSSEDTDSDTYTI----------------SQTLFDALTGRGFSENAI
KKSIVAGCI---------------------------------------------------
------------------------------------------------------------
-----------------------------------DEATCTQWIQMHEGHPELDTALEDG
AEVI--------------------------------------------------------
------------------------------------------------------------
--------IK---AKRVLTEAEREAKVRE---------LQERVRRNKEEEKLELQRKERE
RLE----VGRKMLRMKSEMEEVRRKMNAEEARRENAADLEARQRIKIQIAADRLERRGHT
REEALALAEKEYEEAAANARAEAAAKLETLQGAQAPAQTTTSSSDGTWNLSAVTAPSSAQ
NTLLGLFAGEAP---------TCAQSLVENIR-KRASAEQTGECVRTLRLILG-------
---------------------NIVSDPFDMKKRTLRIST-KAFRDAILPVDEAVRLLRWC
GFDLSTD-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------AASNQTLCLST
VVVRRLHQAL-ALLDSEW
>gi|146164469|ref|XP_001013090.2|	   430 residues, 50 /line  UBX domain containing protein [Tetrahymena thermophila SB210]
--------MSEVSLLLKNIAKE-------I-----GKDEKIVQPFI--------------
--NILED-------NFYDTIESIKDL------------KTEDYEKWKFPKRISDLIIQKI
QETLQG------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------KPQQGQQSVQSNVQQQQTQQSNQVV-----
----------------------------------------TQQSEMVSEPS---------
----------------------------KQELIV--------------------------
-----------------------QKLQDLQKS--ISTTQRYIDLLNFVKKIIS-------
---------------------NIAANPKEQKFRRIKQSN-QHFQINFLPNKEALEFMYLN
NFKLDEEGIFL-------------------------------------------------
-----------------ADQDLDIET---LNLSIIN------------------------
-------IDNALIEATPSN--FNPYQTYTSGNEVLCARNLAQKEGFVNYYE-------EL
QKLKAKRLQVMSQPVSDRK------------TRVFIQNQN--------QSRQMEM---QN
EEVEEN-QLLREF----SDQLKKMIQ---NLDKQQFS----SKSKQEYEK------LLKD
PVYTKS-LIRIKFPQNVILEGNFSPMETIKHVIDFVALNLEN--PE--VPFYLFQSPPRQ
VF----------DKRFHQKTLDEMGCLPGAVFYFAIDNDPEF--------------QKKF
Y-----------------------------------------------------------
-----------------------------------------------------LKTEFKQ
Y----------------L
>gi|146185668|ref|XP_001032295.2|	   396 residues, 50 /line  ubiquitin-associated, putative [Tetrahymena thermophila SB210]
--LFEFQF----------------SNQLIK-----KQQVNRQIDFL--------------
--KQMDSVIGQIVSMGYDQELAQKCFNA---------TKSTDLN-TNIEWIEKHLEQEAI
KESLKG--------T--EEGQQQQHQEQ---------KPAEEKPNEESKENNAEGEQQ--
---------------------------KWGPISHLVDPLMVAQLQDMGF---S-------
------------------KNVSEKAIFMTQ--DQKTLEAALAWTEKHQGDADYEEQLLMQ
ITD---------------------------------------------------------
------------------------------------------------------------
--------ET---NKPKLSEAEARQKARELQNKLREERKKREAQEELDKEKRRIMSGKSM
GDA------------QREIQELKKRQEALQLKQQREQDAIDKQRMLEQLQRDREERFGKK
FAGSKPTEQQAKEP----TPFEKFQVGI--------------------------------
-----------------------KQVKTAHPR--NIFLDKAQVCLKTIQIYIQ-------
---------------------NIVNNPTEEKFRKINLEN-KAYQTRVGECFGAKETLLYL
GFVEEGTFL---------------------------------------------------
-----------------ANHNPNFEI----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------LKQALTF
-----LDKEI-ST----S
>gi|17557230|ref|NP_505652.1|	   552 residues, 50 /line  B0024.10 [Caenorhabditis elegans]
------------------------------------------MLMR--------------
--QVLEEACLKS---GFEVNSHRLQT-----------QSRKPID-SSLPFRLTGLANNAT
LEMTQKEAVSENTI----------------------------------------------
-------------IELAIQTASGARHQKKVGVNQMLLDALKSFTSEFKEDLAT-------
------------------TIDGSVPCIVYM--NKRYTGAELAVNSLSSLGVASGKCLIRH
MRV---------------------------------------------------------
------------------------------------------------------------
----------------KLSDQELATMQAKLQEENERKKALDVNFVKLKAENAERDRLERL
RQE---------------------------------------------------------
------------------------------------------------------------
-----------------------AFDKDKESR-EKREQEQLRALI---------------
PEPASNIQDSTVMDTTESQQRDVLQEVPEQNPNSWSFDG-PAFSRQVPQNTMRMEELNRL
LERVDHSLATP-------------------------------------------------
------------------------------------------------------------
--------------------------AVESRMDAMVNALADGGRIS-LAEVRTRADVAME
QEQEEDPVEVFANP-CDRQ------------AVIYKKRA---------RVQTTDEPMETE
EFFEVGIEDVRNM----QK---DLRKAVRDQTQASFIS---KEYLAKKNR------QLKL
EAYKHT-VIRISIGEH-ILQVYFNTAEQSSNLDLFLNNVLTR------SGWKLMFTNLKV
VT-------------NELKNFVDIELAPKSTLIASFGGQTV---NAADV--------VHN
V-IEV-----TPEKADAMSADWLSL----NKTFMPFNSTVNDDRKQKRPQF---------
-------------------------------------------------QSSSSSSHSGP
PAKSAMPKWL-QT--GKK
>gi|41054205|ref|NP_956104.1|	   437 residues, 50 /line  UBX domain containing 1 [Danio rerio]
--------MKKFFDDIKKDIK---------------------------------------
------------------------------------------------------------
-------------FK--SAGPGKKLTDESSSKPQ---------------ASQASHAASRK
APTAGAQMA-GAAALARIEQQHR-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------PKVHTSQDAIRNQVKRELEAEAAAVVASLKN
TEI----------------EGSAVPQRDPS---SFSVSGVFFTCPLTGK--TVTKAEREL
H--IKEAILMRF----------------SEDAIE--------------------------
-----------------------ASIMMIHTF--NKDKEKVKAAIDIISKYIE-------
---------------------NICKNPTEEKYRKIKVGN-KVFQEKVSGIEGAREYLQAV
GFESST----LPIDGE--------------------------------------------
------------------EKTEDFLVLPEQDSDALE------------QMKIHLE-----
----------------------------------------------------------RL
QKGEA-----VRAK-LDRQ------------LQVFRPS---------QNATHFEL---PP
DFYNLSAEELK-------KEQQLKSEMVE---RNAMLR---TKAMREKDE------QRER
RKYNYA-LLRVRLPDGNILQGTFLAWERLSALYQFVRDSLEN--DW--QPFELMAPGGQK
LK------------DDEETPINECNLAPAALLTFSWDAA-----VQADI--------AAA
G-GKT----AVL------------------------------------------------
-----------------------------------------------------LKQALLE
NIKS------------LS
>gi|45188023|ref|NP_984246.1|	   417 residues, 50 /line  ADR150Cp [Ashbya gossypii ATCC 10895]
----------MSSVRVEYGYS-------VF-----RCKVTPGSLAN--------------
--DILQQALEHF-KLDGGKQQWTLSH------------GGKAVT-LCLPFRQLNLPTGCA
LKLTSVSSGSVGTAA---------------------------------------------
-------------VTIKYQAMGVGVQIRQVSTGALVQDELRLTCQAAGWPMEP-------
------------------VGQFMVS---LF--SKTLTFDEVAGLTFRDLGVNEDVMIRLR
L-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------PG-STTRKNSNASVGSVGARASS
SRKSEGSGSSQRCK----------------------------------------------
-------------------------------------------------------PEEPA
QKTHS-------------------------------------------------------
------------------------HTKKLHKVLALVPSRSSSTSKAPEKPLVEED---SE
GDYELSEQDVLKY----QSM---LAKRAM---GGPLL----TKRLREEMD------NKTH
KKVEQC-NIRVRLPDLTHLEACFDKDDTMEDVYKLVSQSLAS--PS--IEFTLTQSYPHV
KL-----------ERSKQKLVDDLQFSSSTLIVLDTSH------PGPY--------LRKS
L-LEKSKKISAANKQLH-------------------------------------------
--------------------------------------------DKEASSSKTEHAPKEK
LSLKKIPKWM-KL--SKK
>gi|47223847|emb|CAG06024.1|	   545 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
---------GVSVTVLAPNGR-------RQ-----TVKVSPNTPLL--------------
--QVLEDVCKKQ---GFDPEEHGLKF------------QRTTLD-LSLPWRFANLPNNAK
LEIVTCTRKQAIT-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------ESQVSIAL
Q--LENGLR---HQ----ASFSCEQSLWDVV-----------------------------
----------------------------------------------AHFPQTS-------
---------------------AAALSDSGSTPVCVYMRN---------EVSGTEALQKAT
LKSLGLTGGSAIVSSQDPLEKQLSPCFTATNT-LADPQEDVSAPPCDVEQSSVSAVSGKE
DGEEAGRSGLDTSSHPSLSATATFIPFSGGGQRLG----------GPRTGEVGGSPASPV
SLPSPSALSAAVDSPKAKKAKSSSHAVPRSPNHFVL-------------------SLQSL
FFPSL----ICVQP-IERK------------PLVYQPDSA----MSSHSTDLDNL---PD
EFFDVTVDDVRKR----FAMLKSERKLLE---EAPLM----TKALREAQI------KEKI
ARYPKV-VLRVQFPDRRILQGFFRPLETVGALRCFVRSHLED--PQ--LSFYLFITPPK-
-----------TVLSDPSATLIQADLFPGALVHFGSDTK-----TDVYL--------KRG
F-IQSS---VSAQQANESVSRCILG------SPGPSCSSAE--PPPSPETPADASTSTQE
---------------------------------------------ERAPSARCPAAKAAR
SAPGAVPKWL-KLP-GKK
>gi|50287653|ref|XP_446256.1|	   429 residues, 50 /line  unnamed protein product [Candida glabrata]
----------MSSVHVHHNVS-------SL-----KVPVNGSTTLK--------------
--DVLNVATKHY---NLDPERYTLQK------------DYETLD-LSVPWRFLNMAQNSK
FELVEMQVREDNAIA---------------------------------------------
--------EPPKTIRIRFQIVDRGSFIKELSNNITLDKALQEIIDENQLDFA--------
------------------IHNAHLQ---CF--GRQVPAELLASTTLNSLGIQSASNIKVL
ITD---------------------------------------------------------
------------------------------------------------------------
-----------------RDQ-----------------IAQPHLKRESEESVESPE-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------KIQLVNEKEITEP------------
--------------------IKVSKPHELHKPQVYLPPKT-SVSERVRNEIDNNI---AD
DDYELTIEHAKLY----QSM--LAKQTGS---LGGPLM---TQRMRQMQDN----VKNNK
HSVDEC-FIRFKFPDLTQIEISFSPEDTMHTVYNIVRELLIS--TD--LNFGLYRTHPHL
LL-----------DDSELRLVADLQFGAKTALLFEPNNKSNKGPY-----------LRGS
V-IDSGESISNIIDPKIN-------------TTADTETEKEPSPTRKVSAAF--------
--------------------------------------------------------SSSS
TGPKKIPKWL-RL--SKK
>gi|54262234|ref|NP_001005818.1|	   427 residues, 50 /line  UBX domain containing 1 [Xenopus tropicalis]
--------MKKFLDGLKSDIK---------------------------------------
------------------------------------------------------------
-------------FK--GAGPGHKLSEDTRENVAK---------------VTKEQVKPRK
PPTGEAQIAAASAAMARMESLQGR------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------TKVQSKDTTTGRKEMIEQKEESNVGPK
-------------------DIGTTRKK------SSSVCTVLFRCPLTDE--LLRKEEREG
H--IRNVLQRLS----------------TTDPTS--------------------------
-----------------------AAILKIHTY--NKDREKVKLGTETIAKYMN-------
---------------------NIISHPEEEKYCRIKLSN-KVFQEKISCLEGSHEFFEAV
GFEKKT----MPGQD---------------------------------------------
-------------------LQEEFFVLGGDALKNLD------------ALHGHCD-----
----------------------------------------------------------AL
LSAEP-----LRLS-LERQ------------LRIFMPS---------IEAAHFDL---PD
DFFNLTAEEIK-------REQRERTEMVE---RNAVLR---TKAMREREE------QREM
KKYNYT-VLRIKLPDGYILQGIFFARERVSALFDFLREQLQN--DW--LPFELLAPGGHK
VE-------------NEQATLIECGLVPSALLTFRWDEA-----VMADV--------EAG
G-GQSS---VSV------------------------------------------------
-----------------------------------------------------IKPELLS
KVEQ------------LT
>gi|6323712|ref|NP_013783.1|	   416 residues, 50 /line  UBX (ubiquitin regulatory X) domain-containing protein that interacts with Cdc48p [Saccharomyces cerevisiae]
----------MPMVTVKYNFQ-------LF-----KCKVSLNSTLN--------------
--DVLHQSIQFF-QLHTSSNDWSLIH------------LDKPVP-LDLPWRLLNLPTGVN
LELSKSSNFPVAN-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------KTNREDIPFNTIKIRFQIPGRDS-----------
------------VV----KEMPSDQPIAPIL-----------------------------
-------------------------------R-QMSGAAGDDFKIQVFSKII--------
------------------------------EFKTIKDEN-L------------------T
LENLGIQEPSSVRLIFNN------------------------------------------
-------------------TSHSEGISANSAIHP--------------------KQTPPT
MT---NPET---------------------------------------------------
--------------------VASLPPHELHKPSVFLPSDE-----PLAVIKDQIE---DE
EDYELTVEQAKKY----QKM--LSSKAGT---LGGPIL---TKRLREQSAN---NLPKKN
KAISEC-LLRVKFPDRSHIQIAFKPNEDMRTVYNVVSQFLID--EN--MPFTLNQSHPFK
P-----------LAKDDKKLLDDLEFGSKTMLLFETNSN-----SNGPL-------IKAH
L-LEDAQKITHETRTTPSVNTINK------------------------------------
----------------------------------------------SNPQGPSDNATSIK
KTLNRVPKWM-KL--SKK
>gi|6599275|emb|CAB63755.1|	   554 residues, 50 /line  hypothetical protein [Homo sapiens]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------Q-PRMLDFRVEYRDRNVDVV-LEDTCTVGEIKQ--ILENELQIP--------
------------------VSKMLLK--------GWKTGDVEDSTVLKSLHLPKNNSLYVL
TPD---------------------------------------------------------
------------------------------------------------------------
-----------------LPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLNFSGSST
IQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTRE
QSEEQITDVHMVSD----SDGDDFEDATEFGVDDGEVFGMASS-----------------
-----------A---------LRKSPMMPENA-ENEGDALLQFTAEFSSRYGDCHPVFFI
GSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQ-MLCAESIVSYLSQNFITWAW
DLTKDSNRARFL------------------------------------------------
------------------------------------------------------TMCNRH
FG---SVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFT
AQQQE----DIKDE-DEREAR----------ENVKREQ---------DEAYRLSL---EA
DRAKREAHEREM-------AEQFRLEQIR---KEQEEE---REAIRLSLEQALPPEPKEE
NAEPVS-KLRIRTPSGEFLERRFLASNKLQIVFDFVASK-GF--PW--DEYKLLSTFPRR
DV----------TQLDPNKSLLEVKLFPQETLFLEA------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------KE
>gi|73976981|ref|XP_859843.1|	   499 residues, 50 /line  PREDICTED: similar to FAS-associated factor 1 isoform b isoform 4 [Canis familiaris]
------MASNMDREMILADF-----QACTG-----IENIDEAITLL--------------
EQNNWDLVAA---INGVIPQENGI------------------------------------
------------------------LQSDYGGETIPGPAFDPSHPASAPAPSSSSAFRPVM
PSRQIVERQ-PRMLDFRVEYRDRNVDVV-LEDSCTVGEIKQ--ILENELQIP--------
------------------VSKMLLK--------GWKTGDVEDSTVLKSLHLPKNNSLYVL
TPD---------------------------------------------------------
------------------------------------------------------------
-----------------LPPPSSSSHAGALQE----------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------HNFSYRYGDCHPVFFI
GSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQ-MLCAESIVSYLSQNFITWAW
DLTKDTNRARFL------------------------------------------------
------------------------------------------------------TMCNRH
FG---SVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFT
AQQQE----DIKDE-DEREAR----------ENVKREQ---------DEAYRLSL---EA
DRAKREAHEREM-------AEQFRLEQIR---KEQEEE---REAIRLSLEQALPPEPKEE
NAEPVS-KLRIRTPSGEFLERRFLASNKLQIVFDFVASK-GF--PW--DEFKLLSTFPRR
DV----------TQLDPNKSLLEVKLFPQETLFLEA------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------KE
>gi|66534585|ref|XP_393087.2|	   441 residues, 50 /line  PREDICTED: similar to GDI interacting protein 3 CG5469-PD, isoform D [Apis mellifera]
-MTEK---IKSLFQKAKIDVK---------------------------------------
------------------------------------------------------------
-------------FM--NAGKGHKLTDSTSTSGST-SIVE---------------PIKRV
EPTKEAKVA-GQAALARLEAKECN------------------------------------
------------------------------------------T-----------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------KRFNTSYAAIKAQVKRELEQERKAQQKAQQK
NHV----------------QSEEKIENTIKDNFTLAVTNVCYRCPYLSDE-ILSQDEWKI
K--IKKFLYEQLK---------------GEEAGL--------------------------
-----------------------TSCLIIRNC--NSKKEKVDVCVETLGKYLE-------
---------------------NIINYPEEEKYKKIRMQN-KIFQDKVMPIEGALEFLNAA
GFRQKK----ILNND---------------------------------------------
-------------------KEEDFLIWSADNC-SIE------------DITTLFE-----
----------------------------------------------------------AL
KTAQP-----IPLE-LDRN------------LQVLLPM---------QASTRTEL---PP
SFFNLSPEDIE-------KEQQLRSEAVE---RDQMLR---TKAMRERDE------KQKL
RKYKFS-LIRIKFPDNLILQGTFFVHETFQNVVNFVSENLIN--NE--RPFSLKKLPQTT
FS-----------EDTFDKTLLELGLFPATLLMFFWKNKS-----------------EET
N-LNES---VGY------------------------------------------------
-----------------------------------------------------LKEELLS
MIQP-------------A
>gi|66827141|ref|XP_646925.1|	   409 residues, 50 /line  hypothetical protein DDBDRAFT_0190003 [Dictyostelium discoideum AX4]
----------------------MTTPNTNN-----SIELFDNLPLF--------------
FKGRLNEAIQ---KVSTSLDLFVLYV------------IDLEED---QTDVLKCISHQAV
ISFVK-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------SKCILYKIKK----------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------DSTEFEFFSQ-------
---------------------HYPNHSQGSCFYFFDING-KVFKSE--------------
---------------------DIKKGFTFISILSLFKTA-------NDSFEKQKQSLNSS
KIEQK--------------SKERR------------------------------------
------------------------------------------------------------
----------------------------------------LVLQKTFCTKPLPDS---PT
TTTTTTTTTIV-------KSPPLRKKSPE---PEPYIPN-----------------DDYI
TKATMT-TLIFKLTNGETLKAEFNVHDRLKDIKEFIKNNRTD--EN--RPFDMITIYPKH
LF----------TSSEYEKTLLELNLVPSATITLNPLDVSTKVEKKSSAS-ANIHPPSSF
S-SSSS---SSSSSSSGSYFSSVKNYFSGFFGGAIEQPAESKEQDKSSKSSSNNSSGKSS
SQVKKRTNIH-------------------------QINNSNDDDHEQRKQHKDPKDDNNS
YYNGNST------QFNGK
>gi|67610489|ref|XP_667098.1|	   500 residues, 50 /line  hypothetical protein Chro.60425 [Cryptosporidium hominis TU502]
------MGANEVEELILALGK-------EM-----GRKDQEMKIFV--------------
-----DTIVN---KNWYDKIELLKDV------------TNEQWETMNIPLRLVDMIRKRI
FSQVNEPKAEE-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------DSKEEVKEILKEDDTWEFEYLTP----
------------------------------------------------------------
---------------------------ENLEMTP--------------------------
-----------------------SLYNSVESL-GRICKEKLKAVTDILFKIID-------
---------------------SIIKEPRKGKIRRIKMKN-PKFASTVGSFSEALNVLKSV
GFVIVKL--------KPSQIHRIPVDITKYKEQEEEE-----------------------
-------------------KEEEYLELPIAYISRLTDCHHLLAIFCEKNRIEYPKLVSCD
LT---SIDTSGEGSVKISH--FNPYVSNISSTSVSTNNDVSRKLMKSAIEERRKMESEIK
KRERD----MENGT-IDEQNLQDSGNITCTKPFVIHSSNIQKFDNLVKAINDMES---PE
DFDEDDNSHFEQ-----SEIQRIKDSILG---KAPTFK---SRTNEYLKS------LLKR
KVHSHS-SIRVVFPDKYILQLQFRPNHTTYDLIQSVKDCINPNISS--MNWYVYQSPPIL
-----------KVIPDKKLTLLKAGFVPNAQLYFKLELP-----PNHTL--------KGN
Y-----------------------------------------------------------
-----------------------------------------------------IKAQLLN
ED---------------I
>gi|67624297|ref|XP_668431.1|	   393 residues, 50 /line  hypothetical protein Chro.10148 [Cryptosporidium hominis TU502]
--------MSDIGEKVELHIYDLSNGMASQ-----LSPMLLGRTIE--------------
--AIYHTGVF---VYGYEYFYGGGIV------------CVRPEE-IT---RLYGLKPIRT
LTLGTTKKSQK-------------------------------------------------
------ELN-SHLESISNEFNSDN------------------------------------
-------------------YDLLNH--------NCNHFSD--------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------NIVKFLIGEGIPSYILDLPNEVMR
TPF----------------GSMILPMLQKAQKSQAIRSVANVWNTNGINPSNVINKTAEE
FSYLSSGSSSTGSS----RTSHHSRSSGSSDSIS--------------------------
-----------------------EFSKKLSTV-SNKYGWQCQRVLETLETILF-------
---------------------NIISNPGDLRYRSIKSTS-NTLKSVLMSIDEGLELLFLV
GFREKQAE------------DQLRYEIQLSQPLSREE-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------REQLETQINLVRRTLSSLGMA--------------
------------------------------------------------------------
------------------------SEQETQESACPESKASNGSKSESTIDYVK-------
-----------------------------------LLAEVKEMGFEDNKKILQALHKTNG
DISRTVSILL-DE--QSQ
>gi|68072575|ref|XP_678201.1|	   549 residues, 50 /line  Pb-fam-4 protein [Plasmodium berghei strain ANKA]
-----MDTDNEVVKLLLRVGK-------KI-----NKNYEQIKPFI--------------
--KIIVE------DNWLDSIESLKKI------------DDN-------EWQKLKLPLRLL
NEIKELAESRG---------------------------------VDETKNDKVLNENNNL
GKCKKNNIM-GSIVMEENEEHRDN------------------------------------
-------------------LTKKFK--------KGISNMCENE-----------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------YIGNSNNANKNNTMQSSLEKERKKDTPSHTL
SIN----------------NHIERENSGKEMNPIVKCDKEKLENLIKNNVIDIQKDKIFY
FSYVNGNYMRYSYS-------------EEKNRTI--------------------------
-----------------------NSINYIEKL-KNIDKNDLKSIVPILCKIVK-------
---------------------NILINPNILNTRILKSTN-DVMKNKILKYDEAKQFLLSI
GFVEIYHFYVMEYIDTLLLLCSYESLQN--------------------------------
------------------------------------------------------------
------ITKDFLKIPSPTNVPFNPFKATITSIDTLKNKIKGDEQ-------IDKLLKEKK
EHIEK----LINQE-VDLN------------PKIYFFQKT---------NNAIKS---KN
DILSNSDKDDKEEEGGDIACLISNIKNLN---KEQTFK---SRTKLELEK------INSR
KIYSKT-VLKILFPDSYILELSFSSGTLIKQVNEIIKTFLNKSIAS--GEWYIYETPGIC
KF-------------DMKKKLSDYNLFPCTIVRFKADDK-----NNID------------
----GN---NSF------------------------------------------------
-----------------------------------------------------LSEESIE
KYFL-------------K
>gi|71659013|ref|XP_821232.1|	   396 residues, 50 /line  hypothetical protein [Trypanosoma cruzi strain CL Brener]
--------MASLSEEI--------------------------------------------
--QRLSELFA---SGALSKEEFKAAK------------EVTIKS----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------YTPLAATAPLLGEV-GRSREEAEV
HAPFPNVNISEFGE----D-----------------------------------------
----------------------------------AAGQPQREKAYTVLEKILR-------
---------------------NLLQFPGEEKYRRLRLSN-PVLHSQLFSVPGAMGFLQSI
GFARCASDDGD-------------------------------------------------
------------------------------------------------------------
------GDEWLRLPGMPCRPFLEEGLRAIHFLRTRSQEV--------------VARNQDF
LRLRR----TLSLE-VRRE------------RCEKAKAVGELRSYIVSEFCSDDV---GD
GLYSSQVNLDKLE----TI---------------------LTNVLRCPSEA--K------
-------YRRLRLGNPAVYAAVLQQRGGMEVLAECAGGEMVEE-AG--EAFLLLREGTVT
EGKLRC----AL----------------------------QAVHAARLA--------VRE
V-QEKT---EQRVREEARAAVRSQARLEREMELRRHCPQHNSEG-----AELC-------
-----------------------------------EET-------QRVGGRRVPVAEALR
FLMGKGRAEE-EEEE-ED
>gi|71990354|ref|NP_500648.2|	   437 residues, 50 /line  UBX-containing protein in Nematode family member (ubxn-6) [Caenorhabditis elegans]
--MNS---FKKFLNKKRVQNH---------------------------------------
------------------------------------------------------------
-------------FK--KSGEGVRLSSGESSSQP--------------SAHAGAAQGGQI
DRVAAADIA-AQAAFKRMQKNE--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------PQQNAGKRRIQMIAKRELEEERRQVE-DLNI
SGT----------------SSLQQPDREQHLEHSSAISRVLYTSELLGEHHIRSKADLLE
D--IKNFLSDQISE-----------ADDENDKVI--------------------------
-----------------------AAVLMLYSL--NK-KHPKETAIETICKYCQ-------
---------------------NILEHPGEDKYKSIRLGN-KAFQERVASVVGGRAFLEAV
GFTEKSEGEDKFLVFT--------------------------------------------
------------------------------------------------------------
---------------KPSDVHLVEALE-------------------------------AL
KDGQA-----VPIK-VARN------------LEIFKLKEG-------QKPKAPKL---AD
DFYNLSTAELKA-------EQRNKEMQVE---RMLTLR---TKEMRQKDE------QMTN
YRYKYT-LIRVRLPGNLLMQGVFGCHEPFSAVRVFVASTLSDALST--SEFTLRDAASQL
VE-------------DESASLAQLSLAPAALLHVVFAEN-----LSD-------------
------------------------------------------------------------
-------------------------------------------------YGQIVADEHIE
IIQEL--------EA-SD
>gi|78706698|ref|NP_001027152.1|	   478 residues, 50 /line  CG33722-PC, isoform C [Drosophila melanogaster]
--------MDKRVTVLLPNGR-------RQ-----NVNVTANMTLL--------------
--EILETACF---KHGYDAEEHCLKF------------HNKVVG-LTQQFRFSGLPNNCV
LEMEQTEKRRT-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------LSNVLVCV
Q--LNDGSR---QQ----GDFSPNDTIWLVV-----------------------------
----------------------------------------------EKLCETH-------
-------------------------VKAYESPVIIYMRS---------EVIGHEQMRQTT
LKSLGILEGRAMMRLIDKKPEDLKTQANVYKAPAVKPRVDNDDQPSTSRSAMAAGGSGGG
GGFAL--------------TSNMIKNLKRTAPEEKASGSEPAKPLGESNQEQQPQPEPPK
YD---WGNGSGYLMNHPPEQKQAENEVEENP---------------------------GR
--APP----VVKII-GPRQ------------AVLFSLDE--------SKKNANDL---PD
SFFDLTVNDLKMV----LRDLKRTSSGDD---DAPLL----TAKLRELERQ--KAMLAKL
NQYKDC-VLRIQFPDRFVLQGMFKPHEPLSKVEDFVREFLVQ--PG--EQFHLFTIPPKK
VL-------------PSGETLLELNFVPNAIVHFGFIKDSLNAVSNRFV--------KEE
Y-VDQL---TSEEGAHYAVQKYRLT------RAT--------------------------
------------------------------------------------------------
-------------ASGSS
>gi|91078460|ref|XP_967570.1|	   514 residues, 50 /line  PREDICTED: similar to CG33722-PC, isoform C [Tribolium castaneum]
-------MSCSTVSVLAPNGR-------RQ-----TVKCTANTTIM--------------
--QIIEEVCR---KQGFKPEDYDIKH------------HNKVLD-TTISFRFSGLPNNAQ
LELATATKART-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------DSEVILAI
N--SESGDR---VM----GNFQPDDTLWSVL-----------------------------
---------------------------------------------------TK-------
---------------------LCPSIKPDDNPVLVYMRN-EIYG---------DNLQKAT
LRSLGLRGGRAMMRLMYRRPDELKVQANVSAPLPTK---PVEEKPFHRTLKTEAEYSKTT
DVKPL--------------QKKTEVDLLKLAREKRKLSSPSKTP---ETETHSPKTKPKV
-----ESDDEKMDVDLPENIANYPKEPVTNP---------------------------SS
SQLED----DFVFL-GERK------------AMLFSLESA-----R--SLPAEDL---PD
DFFELTIDDAKKI----LGDIRRKRNEMD---NANLM----TSAMRNLEES--KKQLRQL
RKYKQS-VIRVQFPDRSILQGSFKPSETVKDIKDFVTSFLED--PN--SDFHLYTTPPKN
VL-------------SDESKLVEIGCVPGALLHLGANGDG----SSVCL--------KAE
L-RDKF---TTNSKASLAASQLRQK------GTRPESPSEEMGQDESMDTLTE-------
-----------------------------------ANA-------AGPSTQPTSYERKVI
KSTEKVPKWF-RPS---K
>gi|91085807|ref|XP_974668.1|	   438 residues, 50 /line  PREDICTED: similar to CG5469-PD, isoform D [Tribolium castaneum]
-MADK---IKKFFAKKKADAK---------------------------------------
------------------------------------------------------------
-------------FK--LAGPGHRLNESSTAIVGP-SKQKP------------AYVPQRS
QPSDATRQA-ADAALARLQNQSRN------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------PNFNTSLAAIQAQVRRELEAEKKSTEPVAP-
--S----------------APVQTNLETSP---HLAVKGVYFRCPLISEE-VLTKDEWKV
K--IKEFLFEQL----------------EEERGL--------------------------
-----------------------TACLIIQSC--NYNRNKVKECVDVLVRYLD-------
---------------------NIIANPQEPKFHKIRCSN-ATFRDKVLPVLGATDFLLAA
GFQQQV----LSHNG---------------------------------------------
-------------------SDEEFWVFDEQNIESLQ------------VLELLRE-----
----------------------------------------------------------AL
KCEDR-----VELE-LDRN------------IQVLSPA---------QAAQRIDL---PQ
EFYALSPEEVK-------REQQLRTEAME---KQMQLR---TKAMREKEE------LREI
RKYKFA-LIRIRFPDGLYLQGTFSVYEKFSEVLDFVQDNLEH--SG--LPFVLTSPTGHK
F-----------EESDNEISLAQLKLVPATILTFQWDAS-----VADEF--------ARA
G----N---TSY------------------------------------------------
-----------------------------------------------------LKPEVMM
LMQQ-------------L
>gi|118103170|ref|XP_001232670.1|	   438 residues, 50 /line  PREDICTED: similar to UBX domain-containing protein 1 isoform 1 [Gallus gallus]
--------MRKFFQEIKADLK---------------------------------------
------------------------------------------------------------
-------------FR--SAGPGQKLSEPARVPKE--------------KPKTEAAPKPRH
GPTDEAQMA-AAAALARMELK-PK------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------AKPPSSQGAIKNQVRKELMAEAAASVKGVSA
DQE----------------DPAFSDKETAA---EPSVSGVYFICPLTS-T-VVRKDGKEK
H--IREAIKSYF----------------SVDPVA--------------------------
-----------------------ASIMEIHTL--NKDREKVRVGVETMAKYLD-------
---------------------NIYLHPEEEKYQKIKLQN-KVFQERINCLEGIHRFFQSV
GFETRT----LPVPGQ--------------------------------------------
---D---------------TTEEYYVLKEEMLTKLE------------DLKDYKE-----
----------------------------------------------------------QL
LSCEP-----LRLQ-LDRQ------------LCVFKPS---------PEAARFEL---PN
DFYNLTAEEIK-------REQRLRTEAVE---KASMLR---TRAMREKEE------QREM
RKYNYT-LLRVRLPDGYLLQGTFYAREPVSVLYNFVREALRD--NW--LPFELLGPGGLK
LT-------------DENLAFNECGLVPSALLTLAWDAA-----VMSDI--------EAS
G-QEQP---ASP------------------------------------------------
-----------------------------------------------------LKPELLS
HVQT------------LS
>gi|126323129|ref|XP_001365542.1|	   439 residues, 50 /line  PREDICTED: similar to UBX domain containing 1 [Monodelphis domestica]
--------MKKFFQEIKADIK---------------------------------------
------------------------------------------------------------
-------------FK--SAGPGQKLTDTAGEKGSK-E-----------RQSQQASKQPRQ
GPTNEAQMA-AAAALARLEQKQPR------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------SRGPTSQDSIRNQVKKELQAEATVSGISESS
GAN----------------VIPEAKEEGSA---NLSVTGVYFTCPFTG-A-ILRKDQRDA
H--IKEVINEYA----------------DKDPVT--------------------------
-----------------------ASIMKIHTF--NRDREKVKLGVDTIAKYLD-------
---------------------NIHLHPEEEKYRKIKLQN-KVFQERINCLEGANEFFRAI
GFEKTS----LPVPEQ--------------------------------------------
---E---------------ALEEFYVLGEDA--QVE------------KLEQHKV-----
----------------------------------------------------------AL
QNSEP-----VRAQ-LARQ------------RRIFKPS---------PLAAQFDL---PG
DFFNLTTEELK-------REQKLRTDAVE---RLSVLR---TKAMREKEE------QREM
RKYTYT-LLRVRFPDGHILQGTFYARERLSALYSYVREALQS--DW--LPFELIPVGGHK
LL-------------DDSLAFNECGLVPSALLTFTWDAA-----VMDDI--------KAS
G-AEQP---PGA------------------------------------------------
-----------------------------------------------------LKPELLA
TVES------------LS
>gi|109119159|ref|XP_001112862.1|	   447 residues, 50 /line  PREDICTED: similar to alveolar soft part sarcoma chromosome region, candidate 1 [Macaca mulatta]
-MAAPAGGGGSAVSVLAPNGR-------RH-----TVKVTPSTVLL--------------
--QVLEDTCR---RQDFNPCEYDLKF------------QRSVLD-LSLQWRFANLPNNAK
LEMVPASRSREGP-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------ENMVRIAL
Q--LDDGSR---LQ----DCFCSGQSLWEL------------------------------
---------------------------------------------LSHFAQTR-------
---------------------ECLQHPSGATPVCVYTRD---------EVMGEAALRGTT
LQSLGLTGGSATISPG--------------------------------------------
----G--------------PSKPKKSKSGQDPQQ---------E---QEREREPEPQK--
----------------------------------------------------------EL
GLERP----VDLEP-VDRE------------PVVCHPDLE-----ERLQAWPVEL---PD
EFFELTVDDVRRR----LAQLKSERKRLE---EAPLV----TKAFREAQI------KEKL
ERYPKV-ALRVLFPDRYVLQGFFRPSETVGDLRDFVRSHLGN--PE--LSFYLFITPPK-
-----------TVLDDHTRTLFQANLFPAAVVHFGAKEP-----AGVYL--------EPG
L-LEHA---ISPSAADMLVAKCMSR------VAGSPSPLPAPDPAPESEPTAE-------
-----------------------------------EGA-------LGPPEPIPGTAQPVK
RSLGKVPKWL-KLPASKR
>gi|110766101|ref|XP_001122857.1|	   384 residues, 50 /line  PREDICTED: similar to CG33722-PC, isoform C [Apis mellifera]
------MATNKNVIVLVPNGR-------RQ-----NVAVTPNTTIL--------------
--QILEEVCQ---KHGYNVDNYDLKH------------FNHVLD-PNAILRFTGLANNAQ
LEMIPCTKIRS-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------TSTVVIGI
Q--LENGER---LM----NFWNRSFKKYNFKVLG--------------------------
-----------------------IIMVKLYTV--RLVHRN-PKNIDSVTSATL-------
---------------------KTQKEDKIIPSTSTGIGN-QILMQSCS------------
------------------------------------------------------------
------------------------------------KRESDDL-----------------
------------------------------------------------------------
----N----NIEFL-GERN------------ALVFNQATI-------QGTFRDEL---PD
DFYDLTVDDAKIL----LRDAKRYRKELE---EAPLLTNVQRQSNQKKQI------LNQL
NKYHYT-IIRIQFPDQFVLQGLFQPMETVQAIKDFIKCYLSD--EN--SDFIIFTTPPKH
IL-------------DPNSHLINENLVPCAIIHYSGSST-----LKSDV-----------
--KQKF---TDPKKVELQVAKTSRS-----------------------------------
-----------------------------------------------AFNTSTTNNELLN
EKKNKIPKWL-NS--SLK
>gi|115479057|ref|NP_001063122.1|	   433 residues, 50 /line  Os09g0401600 [Oryza sativa (japonica cultivar-group)]
----------MMKEKMK---D-------LM-----RKVTSSS------------------
------------------------------------------------------------
-------SSSSSSSS--FKGTAHVLGSGPDPSSRP-SNPTPSR-----------------
PAAPRREAA-ASAR----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------PPSSGFAP
YSP----------------LISTSSRRTDPPAGAGAGEDDAVACPSCAEP-FPSELAVSD
H--LDGCLAAA-------------------------------------------------
-----------------------GGARPRAAA--YLAGDPPASAVEVVKRLLG-------
---------------------NLLSDPRNDKYRKVRLGN-PRIKEALADREGGVDLLEAV
GFRVADEGGELFALMD--------------------------------------------
---EV--------------PGDARLGGIRQAVLLLERARPSTPP---QTQADAKETCP--
----------------------------------------------------------NG
VSEEQ----GIKKP-VDRQ------------IRVFFSVAA-------SSVAENDL---PD
SFYSLSNEEIR-------NEAKMRRERLE---QSRLLI---PKSYKEKQA------LAAR
QKYKQA-LIRIQFPDGVILQGVFLPAEPISSLYEFVASSLKQ--PS--LEFDLICPAGPR
TRVIPP----FPKPGEQARTLRDEDLVPSARLTFKPKET-----DSV-------------
------------------------------------------------------------
-------------------------------------------------VFTGLLDELLE
TSEPFTSASS--------
>gi|147856981|emb|CAN79664.1|	   474 residues, 50 /line  hypothetical protein [Vitis vinifera]
--------MGDMKDKVK---G-------FM-----KKVNXPF------------------
------------------------------------------------------------
--------SSSSSGK--FQGQGRVLGSSSSGPSNP-IHTRPS-LPVETKPKPPSVAPPNP
RPLPQTTLA-SDQRKSNSDQNKSN------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FQH------------------NSKPVDGFDP
FDS----------------LVTSGKRS------KHGYSLNVFECPICGQS-FTSEEETTI
H--VDSCVNSGVEH----NDNQHSSELSNGDNGS--------------------------
-----------------------TELEDRVGV--FLSGKPSEGSVEVVLKLLR-------
---------------------NIAKEPGNAKFRRIRMGN-PKIREAISEVVGGVELLECV
GFQLREEGGEMWAVME--------------------------------------------
---S---------------ATKDHIVLINMAVSLLE-------P---QKMENSSSPVS--
----------------------------------------------------------EA
DVEEP----VVLKK-VDRQ------------IRVFFSVPE-------SVAAKIEL---PD
SFFNLSIGELK-------READARKKKIA---ESQLLI---PKSYKEKQA------KIAR
RRYTKT-VIRVQFPDGVVLQGVFASWEPTSALYEFVSSALKE--PC--LEFDLLHPVVIK
RRVIPH----FPAAGDRATTLDEEELVPSALIKFKPIET-----DSV-------------
------------------------------------------------------------
-------------------------------------------------VFTGLRNELLE
ISEPLINDSA--V--AQA
>gi|67521585|ref|XP_658855.1|	   409 residues, 50 /line  hypothetical protein AN1251.2 [Aspergillus nidulans FGSC A4]
--------MECFVSFLKSELG-------FR-----IRIRIRTRIYT--------------
--RGLAVPQH---ERGTATTGHAVGN------------DRHV---PGSVLRLMEQDYGFV
AEMILFVNTTYSSKR--FKGRARGLSKA--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------GGVWLY
FGE----------------IAYAGLAG--LPGRYHYYLLVKFTISVYHTS-NFLSQL---
------------------------------------------------------------
-----------------------------------GPGPAKRQYIAALIRLVD-------
---------------------PRVSHSRSLPFREMSSCR-SSFVSILNNDDNPAFAVRST
YGIPTHYPTSSQYQLE--------------------------------------------
---P---------------PSAKSTSEYHYGRTYSD----SPSP---RVMRQAFDPVT--
----------------------------------------------------------EA
TRAAS----PGSSD-CSSY------------DYTASSGTG-------SYYHPYAR---HD
PYAYHPRPD----------------KRLS---GNSMAE---PPSPQTSIA------STSK
ESVGAKPARKNKYPCPFAASHACTATFTTSGH---AARHGKK--HT--GEKSVHCPICNK
AFTRKD----NMKQHIRTHRTHSEE--MSANSTSRSSDA-----SRE-------------
------------------------------------------------------------
-------------------------------------------------WAARRTNR---
------------L--YDH
>gi|124513308|ref|XP_001350010.1|	   397 residues, 50 /line  hypothetical protein PF13_0151 [Plasmodium falciparum 3D7]
MTDYK------VASTCIEELKEICSELL--NAKEEEV-FNKLSL------YDEFEEKIK-
--KIQPIITRIRI---------------RRNETNEEKKIYGEKM-IKNVDILLERFDILY
NIYEEELTIFKENYE---------------------------------------------
-------------------------------------------IEKNRKIEKMLLEE---
----NEKKKNEKELLNRGRIKTQIEQEEILR--RNLEKENLLKKEQEE-------YDNKM
YRIETMKTIIKEKCNFLYDEISNACNKYETIKYIYTQLNGNNVNFNNIFTNIINDNYNDN
ENEILLNNSIYFIDCIYMIYKNNEFK----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------LFKEALKNLIEYLE-------
---------------------ELIKNIDNQQLKLINLMN-KTFQKNILSKKGILFLFILI
GFVLKKPD----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EIKPLLKNINTDINY------ENIYIYLEEPNI
TT----------NYDQWKLWFQHIQKCLTILCTFFRHIHKF-------------------
------------------------------------------------------------
-------------------------------------SDVPDDEKIKFIFLYLK------
-EKFSNEQNVS---TLGT
>gi|145501063|ref|XP_001436514.1|	   477 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
MGMCQTKKMTDVHQPKMLDISQNASQVL--QDQYPMP-KPKLSMGFPCVIKSFEQIQII-
--EVTESMAYNFI---------------VRLGVNQQKQVQKDLD-YQGVFLFSEKAKTNF
FEYGFTPIDVSRPNK---------------------------------------------
-------------------------------------------IIEDKKQYKFLFDFKNL
WAFRDYGEKIESVLNVFKEINVKVKQVYILT--KPLNTFMDQYQMLSEINILNSYYPLLI
FDYKDVSDATKRGDDTFRIYLHSEDAFEILMKKNQISLYNRNLQIRNLIFLYQCVNFSGI
K---KLEESLYKVSCYSLIQQPSGSLNTHQLVKELIPYLQNLQSMGSNVVLIYSSREPQG
LKSARFTIEQYMARGLLIHPEDIQKYNDQLRSLYIKPE---QLTQQLQKQDTGRQK----
-------QQQEVIQLSREQEIINL------------------------------------
------------------------------------------------------------
---------------------------YDSWLKKIKSQQLLQSSHNLFLKLIT-------
---------------------NIIENSSDEKFRTIQKSN-KTVNLNILQYEEGRQILQLI
GFREGETD----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------YKNIFEVGQ------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------IKMARAD------
-IEIAWKKQLE---KSLK


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.