FANDOM


In the plant Arabidopsis thaliana, At2g01650.1 is a gene model for the locus At2g01650.[1]

Also known as PUX2, this gene model is classified by TAIR as "PUX2 (PLANT UBX DOMAIN-CONTAINING PROTEIN 2); nucleic acid binding / zinc ion binding". It is located on chr2, region 284850-286393 REVERSE.

Physiological functionEdit

At2g01650.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g01650.1/Expression

Subcellular localizationEdit

At2g01650.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g01650.1 has 458 amino-acid residues and a molecular weight Mw = 51.059 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is -3.99, or -0.009 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g01650.1/Knockout

Protein interactionsEdit

At2g01650.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g01650.1 has 1 recognized domains:

  • Domain_0348_0435 UBX domain (PF00789, IPR001012) Description: UBX_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g01650.1
MDDVKDKLKG FMKKVNLSSS SGKFKGQGRV LGSSSSSSAP PVNPIQNRFN SSQAPNPTPR PKPNPNPLPE KPLSSSDQKI SGSTRNPDHD PVRAPQDGFD PYGAFITSSN RSQNGYSLSM FECPICKNPF TSEEEVSVHV ESCLGDTNGD ESSFEKDNND NDKSEMEKLV VVYLSGKPSE SSIDVLLRLF KNIVKEPENA KFRKVRMSNA KIKEAIGDVA GGVELLELVG FELKEENDEI WAVMDVPSEE QSILINKVVG YLEKRKTESS GSSAQVMEPV APKKIDREIR VFFSVSENVA SRIEVPDSFY SLSADEIKRE ADLRRKKIAE SQLLIPRSYK EKQAKAARKR YKRSMIRVQF PDGVVLQGVF APWEPTFALY EFVSSALKEP SLQFELLDPV LVKRRVIPHT PAPGQKPITL EDEELVPSAL IRFRPIETDS LVFTGLRNEL LEISEPLS
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.