FANDOM


>gi|18379259|ref|NP_565266.1|	 unknown protein [Arabidopsis thaliana]
--------------------------MAVLSTIYSIT-----------------------
----RASTPTMASLTNDSPSPLPSSSPSKLPSPTSPSKKPLK---------------LRQ
VSKQMGSQNQQRR-----------------------------------------------
-----------------------------------------------------------G
NKPSIAQIERAFGSGSYRDSEGEM--DMNTVFDELLLGH-ANKFESKIEKKLREIGEIFV
ARTEPKLRSSGKPVLMFTIQWILPIWIMSLLVACGVIKLPFSIPFLDDLIM---------
------------------------------------------------------------
-------
>gi|125563156|gb|EAZ08536.1|	 hypothetical protein OsI_029768 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------MELIASTPIGQPEGHAERRLRESAEWVV
DTTEDRACQAQKSLLLLCMK-IFPLWLLLLSIALGIIKLPFDIPGLDNLLICGHLKEIAV
DMIWTIEVIAVVSYDQVVQLLFFTCLRNNMWISALYDGILVTVILIGGVMYYLRPKISAA
VGICVNV
>gi|125605126|gb|EAZ44162.1|	 hypothetical protein OsJ_027645 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------MATAAS
CCCRRHLAVARAPGPAPCRRRRRRLGLLPPPGAAAGEPVRRIRRRAPGPQPTQPLKSAQP
TQPSVAEVRRAIGLGDDDPSASSRRGERQSAFMELIASTPIGQPEGHAERRLREAAEWVV
DTTEDRACQAQKSLLLLCMK-IFPLWLLLLSIALGIIKLPFDIPGLDNLLM---------
------------------------------------------------------------
-------
>gi|51091706|dbj|BAD36507.1|	 hypothetical protein [Oryza sativa (japonica cultivar-group)]
MRRRQGPSPRAPPPPSVRRTARTLQIRAAAAVLLSSSAAAESGDKARRTTTTSGSVSSSP
AERGRAQIHAAAAVPRLHRPPR-SRSTPPLPSSRAPPQLGPKDNAAASSRATPGGEESRR
RRREEGSRRPEERRAGADTGGGRRGAGAGGGRRGEPAGMSGFGDCMTREEEPSAMATAAS
CCCRRHLAVAAPRAPRLAAAAAVVLAS-SASGAAAGEPVRRIRRRAPGPQPTQPLKSAPP
TQPSVAEVRRAIGLGDDDPSASSRRGERQSAFMELIASTPIGQPEGHAERRLREAAEWVV
DTTEDRACQGL-------------------------------------------------
------------------------------------------------------------
------N



Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.