FANDOM


>gi|15226312|ref|NP_178267.1|	   191 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----MADSDI---------ETSSNQNSNSNTSHSTTSTTSV------------HVTALDG
I-----VSANSLFTVAVFVGISFDQ---------PSD-LTLTDR--TECSAGRDVERDLV
VFEVISFAFFLFSSLVAQGMKLAINLLNSKETD----------E------VFKA----NI
NRDVL---RFGVVGAAGGSILGCVFLLLSIVDVIQLRLGLLSCGN-A-LAIHTVLVLVVL
VSSALSVYIFTVFYSFRK--------------------
>gi|15239293|ref|NP_196214.1|	   175 residues, 50 /line  MEE60 (maternal effect embryo arrest 60) [Arabidopsis thaliana]
------------------------------------MTTSI------------HITALDG
I-----VNVNSLFTLAVFIGLAWNP--TD------PD-NSLVTD--PNCVPTARMAENLV
AFHVYSFASFLFSSLIALGLKQAMRLNIASSFHISTRIDPVVY---------------YV
NKTAL---RFGMVTSGLGSVCGCGFLMLALINVVQIKLGTLGCGASG-HTYAAVVPLVIL
VPSALFIYVSLMLYAFTR--------------------
>gi|90265154|emb|CAH67780.1|	   198 residues, 50 /line  H0201G08.7 [Oryza sativa (indica cultivar-group)]
-------MPTVR-----------------------RRHPDV------------HVKALEG
I-----VSANTFFTVAVFIGITGTI--T-------PS-SSIP----PNCVAGDDIARNFF
LFEILSFGFYLLSSLVAQGMKLAVTLLATDDFYGDGEQKPPPSDDCEEMPAWRAAAPRER
RRAVLRFARPMMLLAAGCSIMGTFFLLLSMVDAIQLKFGLVSCNI-P-LAVGTTFALAVL
VVSGLVFYGATVAYALTHYLP-----------------
>gi|115471331|ref|NP_001059264.1|	   199 residues, 50 /line  Os07g0240400 [Oryza sativa (japonica cultivar-group)]
-------MDTGSGGGGGGG--------------GGGGGTSI------------HITALDG
I-----VNVNSLFTLAAFIGLAWRP--SADG---PEL-AGGADRLGSACAAGDRVESDLV
LFHVLAFACFLFSSIVALCLKQIVRTHPHYRLRSGGGGGSA--V------SRTA----MI
NRVAL---RVGILASAVGSVCGCGFLMMALVNVVQVKLGRLGCGAGGAAAWGAVVPLVSL
VPTAMLIYIGIVFYAFTR--------------------
>gi|115481306|ref|NP_001064246.1|	   199 residues, 50 /line  Os10g0178200 [Oryza sativa (japonica cultivar-group)]
----MDESDEQSNGGGGGGHRGYEWKL---PAALSANTTSV------------HVTALDG
V-----VNVNSLFTVAVFVGLSLAD---------PGELRSLAGD--ASCDAGQGVARSLL
VLEVVAFSSFLFSSLVAQGLKLALNLINSKDPH----------D------TLHA----HI
DARLL---RLGMLASAVGSVVGCVFLMVSMVMVVQIRLGTLGCATNR-AAAKAAAGLVGL
VTTALAVYVGTVFYTFTH--------------------
>gi|18397969|ref|NP_566310.1|	   189 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------MTGA---ENGVRMTSPEASSTSSLATTSV------------HVSALDG
L-----VNVNSLFTIAVFVGLSLAT---------PGQ-HSLEQR--SSCDASADVAKKLL
VFEVVSFSFFLFSSLVAQGLKLALNLLNSKDVN----------E------IFRA----HI
NIKVL---RWGMMASAVGSVMGCLFLMLSMVNVIQIRLGLLSCG-SK-SAAQAVATLVTL
VSSALLIYISTAIYAFWH--------------------
>gi|147780461|emb|CAN74914.1|	   184 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----------------------------------MSSISL------------YEXGLDD
L-----VNVNSLFTIAVFIGLAYSS---------PDE-ESLDDR--AECXAGTSIKRRLV
IYEVVSFSFFLLSSLVAKTLKMHINIFKDE---------------------FKS----KF
CRVLR---CVMLTLAALGSVVGCLFLLLSMJHLIEVRLGKLSCGS-P-SSWIAAGTLIXV
VSVALLFYLPTVVYVLTKSILMELXPPQPPPTTTIFQP
>gi|147820651|emb|CAN65359.1|	   157 residues, 50 /line  hypothetical protein [Vitis vinifera]
MLAAGGEVLLERLPAAGKGGQGVVWQLQELSEQAVRDIWRVRVFQRERGEEKNQSGKLQG
IPLAWRAVFHFVARPDVFVGLSLTT---------PNQ-FSHENR--AVCDAEIDVAKWLL
VFEVVSSSFFLFSSLIDQGLKLAINLLNNKGVD----------E------AFRA----HI
NLKAL---RFGM------------------------------------------------
--------------------------------------
>gi|147828034|emb|CAN68512.1|	   174 residues, 50 /line  hypothetical protein [Vitis vinifera]
---------------------VIQVKSRE------EIRDDI------------HFAALDT
V-----VSLNSLYAASSFLGLSLTT---------IGL-HSIDGR--LGCDANISTIRTLM
LFEVISFAFFLTSSLVAHGLKTMIKLVNAAESN----------E------EFRS----HF
NRKSI---QKVMLCAIFSSILGCIFLILSIVNILEIRLGILSCR-SP-STVQGAVALVVI
VTCGVVFHVGITVLA-----------------------
>gi|15232676|ref|NP_190273.1|	   204 residues, 50 /line  unknown protein [Arabidopsis thaliana]
--------MAISN------------GAVEFLRRRLLPTTLI------------HVTAIDG
I-----VNVNSLFSLALFLGLTTSGNITFPVSSSASE-NHHLRR--CISAKGPALAERLV
SSHVYSFSLFLFSSLIAMSLKQAIRTTTTTTNGNCLEEEARVLN------AGEG----RV
NLAAL---RVGIVASCVASVLGCGFLTMALVDLVQIKLGPLECKRSF-HALAAIVPLVVL
VPSALIIYVFLVLYAFIY--------------------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.