FANDOM


>gi|42568862|ref|NP_178253.2|	   953 residues, 50 /line  ATP-dependent DNA helicase, putative [Arabidopsis thaliana]
-----M--------AAVTLS-PCSMCCGSRRLRSVIVIQAQRGNWNR-------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------IRLSNFFFSKVWNI
SYRSKHKYSDNLLEQVEKYASARLENQSKLITKVAALMECDNVDDFIDKKSDEQVKKDLV
L--------------------------------------------ACKRFPSIILGDSRP
VELYSNSKSYGESSS---ILKTPTDNSF-LPTPMHGGWFDPDNL----------------
----------------------------------SRTLSSFCPELLQNDDSSDPREDILD
--------------------------DGSSFTSKTATSEVEATSDDVFAAQR--FLATSI
DSM-PGLS-KRHSNQLDS-CGFHTMK-----KLLHHFPRTYADLQNAQ-----VDIEDGQ
YLIFVGKVLSSKG------VRA-------SSSFSFL-----EVIVSCEVSGRDRTPE--D
LSHNA-EDKAGKSIFLHLKKFFRGTRFTWQPFLNSIQE--KHKVGDLVCISGKVKSLR-A
EDHFEMREYNIDVLKDE---------------------EESSHRAQGRPYPIYPSK----
-----GG--LNPKFLSDVISRALRVLP-ANM-DPI------PKEITKVFGLPSLNDAYVG
IHEPKTLDE-------ADLARKRLIFDEFFYLQLARLY-QMLQSLGTKIEKDVLLEKFRK
PVLNSVYIEEW-STLTKSFLKALPYSLTPSQLSAVSEIIWDLKRPVPMNRLLQGDVGCGK
TVVAFLACMEVIGSGYQAAFMAPTELLAIQHYEQCRDLLENME-----------------
--------------GVSS-------KPTIGLLTGSTPAKQSRMIRQDLQSGAISFIIGTH
SLIAEKIEYSALRIAVVDEQQRFGVIQRGKFNSKLYG-----------------------
------TSMISKSGSSDSDDTSKADLS--MAPHVLAMSATPIPRSLALALYGDISLTQIT
GMPLGRIPVETHIFEGNET--GIKEVYSMMLEDL-KSGGRVYVVYPVIDQSEQ---LP--
-QLR-------------AASAELEIVT-KKFPKYNCGLLHGRMKSDDKEEALNKFRSGET
QILLSTQVIEIGVDVPDASMMVVMNAERFGIAQLHQLRGRVGRGTRKSKCLLVGS-----
-----STNSLKRLNMLGKSSDGFYLANIDLLLRGPGDLLGKKQSGHLP-EFPVARLEI--
DGNMLQEAHIAALVYIHS-PMTLQ----------------------------------
>gi|109645760|ref|ZP_01369680.1|	   796 residues, 50 /line  ATP-dependent DNA helicase RecG [Desulfitobacterium hafniense DCB-2]
----------------------------MNHLQRAIAAEEKQGCCNT--GVIGGFHLFLK
GILSRLEQLEKN---EDFK---VLKDITGHYKDWSPLQRRQALA----------------
--------------------HLRRFI-------------EEHQELEAHQEAGSQGQASVQ
PENRSLPEKEP-----PQPSDTLPV----------------------------------S
EKSD--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------PD----------------------------------------------------
-----------------------------------------KKERTAKP-----SPSRSL
QFL-KGVG-PERAKLLAQ-IGLHTVK-----DLFFYFPRRYEDR-SLQS---IGELKDGE
LASVAGKVVAGQI------ARGK---------LK----VV-KLSIEQDG-----------
----------R-L--VYAVWF------NQT----YILK--QYPVGTSVIVTGKVRWQQ-R
VPEI--QATD--I-Q------------------------KAGAAQPAAILPVYSET----
-----AR--LSSKVIRTIVQGVLGQAPELFP-EFL------PPE--EGKGWVPRAQAYQE
IHFPRTFHS-------LGQARERLVFEEVLFLQLSVAR-LRSGVQ-----------RENS
PQL-----KSG-ESLVQRFLASLPFELTQAQKRVIQEIFRDMANTQGMARLVQGDVGSGK
TAVAMAALLMAVGSGYQGAMMAPTEILALQHYQSLAAAFKPL------------------
-------------------------GLHVVCLLGSQTKSERDKILTEIAYGKAHVIVGTH
ALIQESVQFHSLGLAITDEQHRFGVKQRTSLQTK--------------------------
--------------------------GE--NPHVLVLTATPIPRTLALTLYGDLQLSALD
EMPQGRKPIMTRKLTERGR----PSLEKFMEEQM-EKGRQIYVVCPLVEESEN---V---
-DLI-------------SATERFQSLLE-RFPNRRVSLLHGRMKGVQKEEIMTAFQKGEV
DILVSTTVVEVGVNVPNATVMVIEGAERFGLAQLHQLRGRVGRGSEQSYCFLLSDA----
---KN----SRRLEVLCETQDGFKIAEEDLKIRGAGELLGTRQHG-VM-ELRLADLSR--
DGRLVEQAYQLAQKVLTH-PDRYPG----------VWQECDQFFSLENIG------LH
>gi|113872861|ref|ZP_01412990.1|	   762 residues, 50 /line  probable ATP-dependent DNA helicase protein [Sinorhizobium medicae WSM419]
----------------------M-----RGKESCADAGRDRRSC-----AKCRSWDVLLP
SAASAIE-------------------IIGLYKRWKAGCQPCQRRN---------------
--------------------YRRNFI--------------------------AMRPALLD
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------PLFSPL
DTL-PGIG-PKTGELYARLLGRETIEDCRVVDLLFHAPHSLIDRRRQPG---IAYAPAGS
IVTITGRVDRHQP------APSG-------RSNV----PY-RVFLHDDT-----------
----------G-E--LALTFFRV----KGN----WLEK--ALPVDETVIVSGKVDWFN-G
RASM--VHPDYMV-R------------------------AAESQNMTLVEPVYGLT----
-----AG--LTSRPLRKSIEAAVARVP-DLP-EWL------DGALLRQQGFQSVKESLQR
LHEPRDDADI----DAQAPARRRLAYDEFLAGQLSLSL-VRQRLR-----------KVSG
TPV-----HPT-GRLSSPVIAALPFSLTSSQSTAVDEILQDMSGTDRMLRLLQGDVGSGK
TAVALMAILAALEAGGQAVLMAPTEILARQHHATLSKLAAPA------------------
-------------------------GITIDVLTGRTKGKERDAVLERIASGETQLVIGTH
ALFQDAVSYRHLVLAVVDEQHRFGVHQRLRLTAK--------------------------
--------------------------GV--SPHMLVMTATPIPRTLVLAAFGDMDVSKLT
EKPAGRKPIQTVTIPNERT----DEIVERLDAAL-SQGKKAYWICPLVEESEE---T---
-DAM-------------SADERYQSLAR-RF-GKDVGLVHGRMTGPEKDAVMLAFKTGDI
RLLVATTVVEVGVDVPDATIMVIEHAERFGLAQLHQLRGRVGRGDEASTCILLYKS----
---PLSEAGRARLSVLRETEDGFLIAEEDLRLRGEGELLGTRQSG-TP-GFLIASLEA--
HGDLLEMARKDAAYVIDR-DPELTSERGAALRMLLYLFRRDEAIRFLRAG--------
>gi|113939489|ref|ZP_01425343.1|	   832 residues, 50 /line  ATP-dependent DNA helicase RecG [Herpetosiphon aurantiacus ATCC 23779]
--------------MFFVLMV-MQANQHIIELGKTLAAEEKAGCDDT--ATDHGISIFLR
EWQAQHPQALHE---PVVQ---GVLDALDGYSELSHAEREARLS----------------
---------------------------------------------------------VAL
DRLRNLFRKQP-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----KAPA----------------------------------------------------
-----------------------------------------EPVG-AVP-----PIDTLL
KTL-QGIG-PSTARSFAK-LGVHTLE-----DLLYHVPHRYDDFSKRKQ---ICDLVVGE
TDTVIVTVDAIKS------FNAK--------GRQ----GV-EITVGDDT-----------
----------G-V--LKASWF------RGT----WMAK--QFREGMRIVLSGKVSMFR-E
MKSM--SNPQWEPFV------------------------EDDLVHTGRLVPVHPLT----
-----KG--LQDRNARQVIKRVVDAVTPTLS-DPL------PIELRERAGLLPLGVAISQ
IHFPDSWAM-------VQRARQRLGFDEFLYIQLGVLQ-RKRLYQ-----------GVQG
QPI-----AFN-QAIHDAYLSSLPFALTNAQTRTFNEICRDLERPVPMTRLVQGDVGSGK
TAVAAAALVQAVAAGFQGAMMAPTEILAEQHYRGLKKLLANVKIPGRETNSNGDWRDELD
QEKRNRLAQIKQLLMLADEPEPEPGGIRVALLTGSLKARQRREALKLIADGEVDIIIGTH
ALIQANVDYQALGLAVVDEQHRFGVEQREALKRK--------------------------
--------------------------GF--NPHLLVMTATPIPRSLALTIYGDLDVSVID
ERPPGRQPIRTKWISSGER----SKAYKHMRKEI-AAGRQAFVICPLVEESEK---LE--
-DVK-------------SAIVEQEHLQHEIFPDLKVGLIHGRMTSSEKDTIMAQFRDREF
DILVATAVVEVGIDIPNATTIMIEGAERFGLAQLHQFRGRVGRGSHQSFCVLVSDK----
---EDNDVTVARLSSMEESEDGFRLAEIDLELRGPGEFFGIRQSG-TP-DLKVAQLT---
DTRLLHAARIEAERILKL-DPELELPEHAKVREKLQAF-WAGMETQS--N--------
>gi|118065084|ref|ZP_01533395.1|	   842 residues, 50 /line  ATP-dependent DNA helicase RecG [Roseiflexus castenholzii DSM 13941]
----------------------MDGKDQIIRLGKLLAEEQRRGCDDR--AVNGGLERFLT
AWRMDAGMALRY---EAVQ---QALELLAGYAVLDQATRRARVG----------------
---------------------------------------------------------IAL
ESLRSLFRAQPNPQPAPVASSAMPT----------------------------------R
APTR--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--RASRPD----------------------------------------------------
-----------------------------------------APAR--PL-----TPDSPL
DDV-PGIT-RQMVQSFRR-LGVRTVR-----DLLYHFPHRYDDFTSRKT---IAELQPGA
VETVIAEVLDART------LPMK-------SGGS----RL-DVLVGDET-----------
----------G-T--LKVVFF------RQP----WLAQ--RFLVGTKVVLSGKIGVYD-G
LRQM--ASPEWQPFT------------------------DDDLIHVGRLVPVHPLT----
-----RG--LVERSARALIKQVVDRCAPMLE-DHL------PPAVRERTGLMPLPQAIAQ
IHFPDSRDM-------LEQARRRLGFDEFLFIQLGVLQ-RKMIWQ-----------AQRG
YAI-----TRR-DDVHEAFLRRLPFELTGAQVRAIEEIFADMARPVPMARLLQGDVGSGK
TVVAAAAALQAIASGYQAALMAPTEILAEQHYRGLRALLGNVPVPRDQRQVSAE--DDLD
PEQRERLEEIKRILGMSGDDDLDGRGVRVALLTGSLGAKERRRVLEGIARGDIDLIVGTH
ALITESVQYAALGLAIVDEQHRFGVEQRQRLKDK--------------------------
--------------------------GY--NPHMLVMTATPIPRTLTRTIYGDLDASVLD
ELPPGRQEIKTRWITTVER----DKAYRHIRREV-AKGRQAFVICPLVEESEK---V---
-DLP-------------SAEEMHATLSRDVFPDLRVALIHGKMLPREKDAVMIAFRNHEY
DILVATAVIEVGIDVPNATTILIEGAERFGLAQLHQFRGRVGRGVHQSYCILVCDK----
---EQNEVTRQRMEAMETISDGFRLAEIDLHLRGPGEFFGTRQSG-TP-DLKVAQLT---
DVRLLQTAYREAQKILAD-DPQLERPDHALLRAKMDAF-WVETLQA---G--------
>gi|115377219|ref|ZP_01464431.1|	   898 residues, 50 /line  ATP-dependent DNA helicase RecG [Stigmatella aurantiaca DW4/3-1]
-------MRDVIPAPYDERSD-SRVSHPLSSLVGPLRYACQRDFAQL--STVRDLRGLLE
RALA-GASGVDA---QALS---VLRAALPHVDAPLIERRKA-------------------
--------------------ALRRIVSALQLSGL---VLPPELARVAQEGAPSAGPP---
----PPAREAPAHEGVPRWKAAEPA----------------------------------P
LLSRGTAPVPP-------------------------------------------------
------------------------------------------------------------
---------------------------------------------------APRPAAKPP
PASAPKPAEPKKP-----------------------------------------------
AAAKKRKRAA-----------------------GAEESRAEAKLLSIAPRSG--PLSTPL
KTLGKRLG-PRLLGALDK-KGLRRVG-----DILFLLPRCYEDRRKLKT---IAELEPGG
RGVTVGLVKTADY------VSGR-------NGKR----YF-KAVVADRS-----------
----------G-S--IAATYFHA-----GP----WLKN--RFTVGKRLVLSGEVRASL-S
GREM--AHPEIEPAEDL----------------------ESSSVHFNRIVPIYPGF----
-----ER--GDQRSFREVASRVSENYAQHIE-EPL------PEALRKRLGLVALPEALRS
IHFPPDTAHLEALDAHQSPSHRRLAFDELFFLQLGMGL-KRQNVK-----------TEQG
IAF-----NVS-PERVDRARGALPFALTGAQARVVEELAQDMARPEPMNRLVQGDVGSGK
TAVAVVASLLALQDGYQVAVMAPTEILAEQHERSFRKLLEPL------------------
-------------------------GFRVGLVSAAGTAKHKREVREALAQGEIHLAVGTH
ALIQGGVAFERLGLAVIDEQHRFGVLQRHTLMSK--------------------------
--------------------------GP--TPDVLVMTATPIPRTLAMTLYGDLDVSIID
ELPPGRTPVATRVFNEQQR----ARVYESVGAEI-AKGHQAYIVYPLVEESEK---L---
-DLE-------------DATRGAEKLQ-QVFPQARVGLLHGRMKAEEKDAVMEAFREQRI
HILVCTTVVEVGVDVPNASVMVVEAAERFGLSQLHQLRGRVGRGAAISFCYLVASL----
---ARSWESSERLAVMEQSSDGFIIAEKDLEIRGPGEFLGTRQSG-LP-ELAVANLAR--
DGDLLSLAQAEARRILER-DAHLQAPEHQGLVKALEER-WEGRLALARVG--------
>gi|116059755|emb|CAL55462.1|	   1259 residues, 50 /line  DNA helicase RecG (ISS) [Ostreococcus tauri]
-MGGLNAARRA--GDGGLTTS-ARDGTTQHRLRAGVEYEISNGCENAKGRAFDDFQSFLT
ASLRELETSHAS---PMLA---HMVRDSMMYGKLDTDRRRMLLNNVSAAL-PGVVQSAAS
TIENASAPRGWAPPRAAAENAASTSSSSSVLAGVGGRTKSATDMKSTTEAMTTTQRTETA
SAGTAPSNAKPTHVEVSRNSSEFPSIIVFDLETTGLSKEKSRIIELAAQSLTDPSAAFST
LVNPGRFNIPPAIK----ALTGITNSMVSAPDVPSFAMAAEQFEMFIEQVRQSRPGAPVL
LVAHNARQFDAAFIQYEYRRLGRELPSSWRFCDTLPLARQLLRPDGLGKFSMDVLRGHYD
IELEGGDVQMHRAGTDARVLADILNKMLEHPRAKGNELRCLEQFSFSLGDPGAGSLKRAT
AEAKSDSERSWSPGGAPGWGGGGTVSLSDGEEADLGGGWAVVDEFENEEKLESSERESSP
NDNVS-LRGVQKPFWAAEDPINGILPETVDFQKLVEITAKTDVSELRLDVER--WKETPI
DVL-KDKVPKSTMKALKA-EGVSTIE-----AVLRNCPRKYQEFSAWNK-----SLAMGT
QVTLTGTVRSMQV------RDYM-------RGRS----IPNTILVEVDLPESEITTSDDN
PWGDNK----P-R--CKVKVWDH----ISK----DMRA--GMPIGARVSVRGTLGTGD-R
NCQFSIDGGRVAPIAED---------------------APILESDGAEIVATYAKR----
-----GQ--MSNVEWHRAISASMDIFVEKLPADPVEVSMGRDNPLLSELGLLSHSEAVKN
IHRPKNVEI-------VAQARERLAFEELLLLQVALLQ-ERSRLQ-----------ALPV
SETTEGVCIVG-TALVDELRTELPFALTRSQESSLEEILSDMAGPAPMLRLLQGDVGCGK
TVVAAMSLLAAVGAGHQGAFMAPTEVLATQHHRVLTELLSQMRD----------------
-------------------------PPKVVLLTGSTKTAERAQILEDLSSGKIGIIVGTH
ALIHEKVVFNSLGIAVVDEQHRFGVEQRAALLSK--------------------------
--------------------------GK-VPPHMLTMSATPIPRTLAMTKFGEMALSVID
EKPAGRLPIITKVCAVDEH----DIAYEAMRDEV-RQGAQAYIIVRLVQESGSSRMS---
-EVK-------------GAEEEYARLVS-KYPNVRFGLLHGQLGAEEKAAALEKFSAGET
QALVATSVVEVGVDVPNASIIIIEDADGFGLAALHQLRGRVGRGSRQSKCFLLHTPGVGE
NAESKEDRARDRLRVLEQSNNGFRIAESDLQLRGAGELFGTKQSG-QQVNLFHASMST--
DLYLLEAARKAAAEMISR-ASLSSEPLPAPIAVALETR-PALVLDNAVVSGGQVVASN
>gi|118054612|ref|ZP_01523135.1|	   778 residues, 50 /line  ATP-dependent DNA helicase RecG [Fervidobacterium nodosum Rt17-B1]
----------------------------MLLIEEFLDNCYQIAKKIEETSLNELIEYIED
NFDKIDDPLLLD------N---EIKQKLSEFTEYILSSKKLPIERALKRL-QQVSGMVER
FKYNYNYLTSTL------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------ECSDVPK--PLDTPI
KYA-KGVG-PSREKLLKK-LGIETIG-----DLINYFPRDYEDRRKIIP---IVFIRENE
KVTTKGIIKSVEK------IK-K-------GDLV----II-SALLQDGI-----------
----------S-Q--VVLKWF------NQE----FKELELKQLINKEVYVSGTPKRGFFG
AIEI--QNPEISLS----------------------------NSPEREIIPIYPLT----
-----EN--LTQKTLRKIIEDNISAVC-NYQ-DVI------PNEIVEIRKLLDIKRAYIG
MHFPRSSFH-------QKLSRKRLAYEELLLFQLALFI-SRKNVE-----------KIGG
IAK-----QLS-GQLAEKFVNSLPFKLTNAQIRAHNEIRQDLMSPNPMNRLLQGDVGSGK
TLVAELAIIDNYEAGFQSALMVPTSILAIQHYQKIFNHLTNL------------------
-------------------------GIRVALLIGSTSQKEKDKIKFALKNGDLDVIIGTH
ALIQEDVHFANLGLVIIDEQHRFGVKQREELISK--------------------------
--------------------------GK--VVDTLIMTATPIPRTLSLTLYGDLDVSIID
EMPPGRKEIKTFTLKHTRA----KEVYKFVKDQIIENGDQAYIVYPLIEQSDQ---I---
-NAK-------------AAEDMYEKLSKEAFADIPMGLLHGRMSDFEKNEVMSKFVKGEI
KILVSTSVIEVGVDVPNATIMVIENAERFGLAQLHQLRGRVGRGSKQSYCFLIVS-----
---EAGEEAWDRLQFFASTTDGFKVAEYDMRLRGPGEFFGTRQHG-MM-DFKVADLIS--
DSELIMLAREDAKWIIEN-RAE-----SSIIKKVFE--LYGDRIKLLDVG--------
>gi|118469068|ref|YP_886743.1|	   753 residues, 50 /line  ATP-dependent DNA helicase RecG [Mycobacterium smegmatis str. MC2 155]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------MMA--TLEDSL
QFV---LG-KKAADKLEEHFGLRTVN-----DLLRHYPRKYSDGMTVRGEGEALDLEEGE
HVTFIDVITEAQPGTMKRPVKTK-------TGKQFTPKYL-RVKLGDHK-----------
----------P-K--VTATFF------NAN----WMID--ELKVGTRLMLSGEVKYFR-D
TVQL--NHPAFLVLESPSGRTIGTKSLKTIAEASGASGEDMLAEFEKEFFPIYPAS----
-----AK--MQSWDIYRCIRQVLAVLD-PIP-DPL------PKSFVQQRGLMSEDQALRA
IHLAANSTE-------RDRARERLTYDEAIGLQWGLVA-RRYGEL-----------AASG
PSA-----PLRVDGLVAALRERLPFELTAGQREVLDVISGELASTRPMNRMLQGEVGSGK
TIVSVLAMLQMVDAGYQCALLAPTEVLATQHARSVRDVLGPLAMA---------------
-----------------GELGGDEHGTRVALLTGSMTPQQKRAVRDEVASGAAGIVIGTH
ALLQDAVEFDNLGMVVVDEQHRFGVEQRDTLRAKA-------------------------
------------------------PEGL--TPHLLVMTATPIPRTVALTVYGDLETSTLR
ELPRGRQPITSNTIFVSQKPAWLDRAWARIREEV-AAGRQAYVVASRIDENDK---P---
-SGGKENEGRQAGPPPITVVELYERLRNGPLEGLRLGLMHGRLSGDEKDEVMSRFRAGEI
DVLVCTTVIEVGVDVPNSTVMVVMDADRFGISQLHQLRGRIGRGQHPSLCLLATRM----
---PENSKAGERIKAVASTLDGFELADLDLEERREGDVLGLNQSG-RTINLRFLSLRD--
HLEVITDARAFCETRYEQ-DPNDTG--MALLAAQF---VNTDRVEYLEKA--------
>gi|125583430|gb|EAZ24361.1|	   1023 residues, 50 /line  hypothetical protein OsJ_007844 [Oryza sativa (japonica cultivar-group)]
-MTAL---RRCFLA------------MLFLETWRLMKAMDRRGATS--------------
------------------------------------------------IQ-PGIKAGSGG
AAAAAAAAAKKKQHQGGPGL--------------NGQTRVPADGDHVAAAAE-------R
KAGHTNQLARVFSLDFRRGRSR-------------------RIPSRMRSSNALGSKLFRW
CSRENHTSVRKLLE------VDGTSERSKLLNKVSVLMGYSNTQELIEQERARRGSATEL
----------------------------------ISVCKEIEFPEMCAKFPCIKIGDSSP
IELYAAAASMSQKET---VLSENLTNFM---RESGGNFGAAYEF----------------
----------------------------------SDKCHPLDPTLTNVDHLSISEESSLT
AQFV----------------------SLEPAVDTDACPESLAVADATVSDSS--ILDRSI
RCF-PGTT-SRQYRQLED-GGFHTVR-----KLLQHFPRTYADLQNPQ-----GSIEEGQ
YIMLFGTVVSSRY------MKYYWRGARLKHTLGYL-----EVVVSCSIIESELSSSVKS
CNSQAEQKKTI-H--LHLKKFFSGTRFSSPSFLKCISS--KYKEGDLAYVSGKIKKAL-T
KDHYDLREYTIDMLEEE---------------------EQQCTLLDRKPYPIYPSK----
-----AG--LKPSLLSLSISRALKMLTP-DI-DPM------PHEVLVEFNLPNLFDAYMG
IHKPKNRDE-------ADFARRRLIFDDFFYLQLGRLF-QMLEAVGTRVEKEELLLKCKN
HELNAVGADEW-SPLARKLLKVLPYLLTPSQLNAVKEIIWDLRRPVPMNRLLQGDVGCGK
TVVAFLACMEVISSGFQG------------------------------------------
-----------------------------------------------LKTGEIAMVIGTH
SLIGDKTEFSALRISVIDEQQRFGVVQRGRFNSKHITAENDPSLQFAILAVITIASISLQ
KMMLYTPSTKSSDDDTISDENSASEIFM--APHVLAMSATPIPRTLALALYGDMSLTQIT
DLPPGRQPIETLALEGNDA--GFESVFQMMSDEL-VDGGKVYLVYPIIEESEQ---LP--
-QLH-------------AAKAEFDSIK-QKFEGYPCGLLHGRMRSDEKDGALSSFRSGET
RILLSTQVIEIGVDVPDASMMVVMNAERFGMSQLHQLRGRVGRGERKSRCVFLCST----
------PSALPRLKVLEKSSDGFYLANADLLLRGPGDLLGKKQSGHLP-EFPIARLEI--
DGSILQEAHLAA---LVN-NPFSDAG--------------------------KIASYY
>gi|126696154|ref|YP_001091040.1|	   818 residues, 50 /line  ATP-dependent DNA helicase recG [Prochlorococcus marinus str. MIT 9301]
--------------MTFSGNNNKLIKEWIRTLQKSLTIETENKFINTLG-RERYFNDYLH
ESLKKLDNLNLS--DEYLRIFYEFSKKYSEYNKLDENQRKRLIIDTRKNL-YKLGKTQEI
ESSNIISNKVFL------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------NKADSSL--SFDSDI
SLI-KNVG-KVYKNKLNE-LGIFHIK-----DLINYFPRTYLDYTNRVK---IINLKPDN
LYTCIANVKRFYI------HKSK-----KNSNLS----IM-NIVVYDET-----------
----------S-S--IKVTKFFLGRRFRSYSFFTSQKS--LYTAGTKLAISGKVKLTE-Y
GKTF--VDPQIEILKDN----------------------NDNYNFSGKILPLYSLG----
-----EA--LSNMSFIKLMKKVLIYA-KQYP-EIL------NKKQLDSLSLLSKGESLIN
IHFPPTQQA-------LIESKKRLVFDELFLLQIKFLL-RKRKTNK----------NVTS
QQL-----PQK-KSLLKEFLNNFPFELTKSQENVLNEIKKDLSNPVPMSRLLQGDVGSGK
TIIAIASLLLVIEKNLQGAFMVPTEVLAEQHYKNLLKYLNPL------------------
-------------------------LVSVELLTGNTPQKKRKEIFSNLNNGLVDILVGTH
ALFEDKVIFNALGMVVIDEQHRFGVTQRNRLLNK--------------------------
--------------------------GD--NTNLLSMTATPIPRTLALSIYGDLDVSQIT
ELPPGRVPITTKIISEDNL----TNLFKIVEDEI-NKGKQAYVILPLIEDSEK---M---
-NLS-------------SAKKTFKYLSEEVFFNKKVGLLHGKLSSQEKNEVINSFLKNEI
NILVSTTVIEVGIDVPNATIMIIYNSDRFGLSQLHQLRGRVGRGSTKSFCYLVTSD----
----KNGLENKRLCVLQKSNDGFYIAEKDLELRGPGQILGYRQSG-LP-DFVLDNLPN--
NKFLIDKAREEAIKIVSG-DPDLK--KNIVLRNILIDN-SDNKFIHDFLN--------
>gi|134294797|ref|YP_001118532.1|	   783 residues, 50 /line  ATP-dependent DNA helicase RecG [Burkholderia vietnamiensis G4]
-----------------------------------MPVSPRRSAATVADSAD--------
------------------------------------------------------------
-------------------PADPFDADAAASPGPGGQPEGAPARRASPRRRADGRLAQPA
AAQQADADAAAA------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------GDGDAAGAA
ATGAAAPKRKKKP-----------------------------------------------
------------------------------------------------------AADKP-
---------VKTADKLAK-LGLTRSI-----DLVLHLPMRYEDETTLTP---IDELLPGG
IAQTEGVVFDNEV------AYRP---------RR----QL-VVKIRDDD-----------
----------GAQ--LVLRFLN---------FYGSQVK--QMAVGQRLRVRGDVRGGFF-
GMEM--VHPAVRVVEA-------------------------DAPLPQVLTPVYPST----
-----AG--VSQAYLRKAIENAVERT--PLP-ELLPP--EIERDYLKPLGVPTLAQAVRI
LHHPGVDSDEAALMDGSHPAWTRIKFEELLAQQLSLKR-AHEERR-----------TRSA
PAMPRRAADDA-GSLTTRLYAALPFTLTGAQSRVVDEIAHDLTLPHPMQRLLQGDVGSGK
TVVAALAATQAIDAGYQAALMAPTEILAEQHARKLRAWLEPL------------------
-------------------------GVSVAWLAGSLKAKEKRAAIEAAALGTAQLVIGTH
AIIQDTVEFARLGLVIVDEQHRFGVEQRLALRAKAANAAN--------------------
-----------------------GARD--FQPHQLMMSATPIPRTLAMTYYADLEVSTID
ELPPGRTPVLTRLVADARR----GEVIARVREAA-LTGRQVYWVCPLIEESET---L---
-QLQ-------------TAVETYETLAA-ALPELKVGLVHGRLSPADKAAVMDAFTRNDV
QLLVATTVIEVGVDVPNASLMVIEHAERFGLAQLHQLRGRVGRGTAASVCVLLYSG----
---PLSLAGRERLKTMRETTDGFEIARRDLEIRGPGEFLGARQSG-AA-MLRFANLET--
DGWLIDPARDAASRLIAA-YPDVVTQHLA---------RWLGAREQYLKA--------
>gi|145621935|ref|ZP_01777899.1|	   781 residues, 50 /line  ATP-dependent DNA helicase RecG [Petrotoga mobilis SJ95]
-----------------------MIEEVINSFDYIVQLKEKGMITWE--EIFPSFYSIAK
NNFKVIQENGLL--E----DVKKILAYTKPLKTLSEERKERRLEGLKDSL-KILKERYLV
DE----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------VLEKPEKKL--APLTDI
KYI-KKVG-TKRALILNK-LGIFSLK-----DFFYYPPRDYEDRRKVVK---IFNAKEDE
KVVIIGNVVKSEE------VKIN-------KGLT----IY-NFSVEDDS-----------
----------G-V--IIVTFF------NQD----YVKS--YLKRGVKSAFYGKIEYSY-G
MKQM--KSPDFQVIESD-------------------------EDFKSEILPVYPLT----
-----FG--IFQTTMRRIAKEAIQQT-YFLE-EFL------PEEFVQEFNLLDLKKRIKG
IHFPLSIYH-------KERSWYSLKYEEAILFELAMIY-LKLKMKE----------MKKG
ETK-----EIK-GELTKKFLNTLNFELTQAQKRSYEEIRKDLISPYPMNRLLQGDVGSGK
TVVSELAIIDVCEAGYQAAVMNPTSVLAKQQFKKLSKDLEPL------------------
-------------------------GLKIVLLTGDTKESDKILIKEKLKLGEIDVVVGTH
AIIQQDVEFKKLGLVVIDEQHRFGVNQRLELIKK--------------------------
--------------------------GN--HPDILVMTATPIPRTLAMTFYGDLDVSLID
EMPKGRRPIKTILIAESNR----KSLYEFVKEEL-DQGNQVFFVYPLIEESEA---L---
-ELK-------------NAISMYEELS-KVFEEYKVGLLHGRLSPSEKNDVMDKFVQKEY
DILVSTSVVEVGIDIPDATVMVIEHPDRFGLSQLHQLRGRVGRSDKQSYCFLVIDD----
---DANNEIKSKMNSFSKTLDGFEVAEIDLKWRGPGKFFGVEQHG-IP-EFKFLDLVE--
DINIIENSRKKVERFLAT-IQSFD--RYPNLKHELQTR-YGDSIHLVNVL--------
>gi|147669719|ref|YP_001214537.1|	   818 residues, 50 /line  ATP-dependent DNA helicase RecG [Dehalococcoides sp. BAV1]
------------------------MGVDTGAFKKILQLEAQKGFADT--AVMGGLDHFLS
RWAKEAVTGINN--PDDLLDFHHLKLSDPNYAKMTEDKRREWVDAILAFL-PKLENQ---
------------------------------------------------------------
----------PIGRPAPQKA----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------PKAKSP
SKTPAKP-----------------------------------------------------
---------------------------------------------KADTRLP--ALDGDV
SLV-KGIS-AATAPKFHK-LGVNTVR-----DLLYYFPNRHLDYSRLKK---ISQLEAGP
EQTIIANVWQSKV------NFM--------SGRR----ST-EAVLGDDT-----------
----------G-N--MRAVWF------NNP----YMVR--NLKPNARVVLSGRVSIFQ-G
RPVF--ESPEWEELPDE-----------------------ADLIHTGRLVPVYPLT----
-----AG--LHQRSLRRLMKNFIDISSPNIS-DFM------PAETLKRTRLLPLSEAIRQ
AHFPDDEEL-------KNAARNRLAFDELFILQLGVLA-KKKRWH-----------EQAG
RAL-----NVN-IPDIDRFVSKLPFKLTDAQTKCLADIKADISKGVPMSRLLQGEVGSGK
TIVAVISLFTAASNGLQGAFMAPTEILAEQHFKSVTRLFASIA------RVSTL------
------LDGIYTFEGLL------DRPLKVALLISDMKGSQKDILKEKIKKGEVDIAIGTH
ALIQKEIRFKSLGLAVIDEQHRFGVEQRSALRSK--------------------------
--------------------------GL--NPHILIMTATPIPRTLALTLYGDLDLSVID
ELPPGRQSIKTRWLKPEQR----NSAYTFIRKQI-QEGRQAFIICPLVEESEV---I---
-QAK-------------AATAEYETLSREVFPESRVALLHGRMNASEKETIMRHFSEGEM
DILVSTPVIEVGIDIPNAAVMLVESADRFGLSQLHQFRGRVGRGTEQSYCMFLAEN----
----PSLLGQERLSIIESTQDGFKLAEEDLRLRGPGEFFGTRQSG-LP-KLRMASI-S--
DVGLLEQARKEATRLFEL-DPELSLPENAPLEAEVRRV-WPKKSEW---S--------
>gi|147735399|gb|ABQ46739.1|	   779 residues, 50 /line  ATP-dependent DNA helicase RecG [Thermotoga petrophila RKU-1]
-MCSRYF----------TSSL-SLWGEALPILLEEFLNEVEKMLKNQ-VNTRRIYQLLQE
LDDPLLDNKDLE--E----KLQAFLDYAKEIPNLPEVRKRYRIQKSLEMI-EKLRSWF--
-------LIDYL------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------ECSGEEV--DLSTDI
QYA-KGVG-PNRKKKLKK-LGIETLR-----DLLEFFPRDYEDRRKIFK---LNDLLPGE
KVTTQGKIVSVET------KRFQ--------NMN----IL-TAVLSDGL-----------
----------V-H--VLLKWF------NQE----YLQTYLKQLTGKEVFVTGTVKSNA-Y
TGQY--EIHNAEVTPK-------------------------EGEYARRILPIYRLT----
-----SG--ISQKQMRKIFEENIPSLCCSLK-ETL------PERILEKRKLLGVKDAYYG
MHFPKTFYH-------LEKARERLAYEELFVLQLAFQK-IRKERE-----------KHGG
IPK-----KIE-GKLAEEFIKSLPFKLTNSQKRAHQEIRNDMISEKPMNRLLQGDVGSGK
TVVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRTIESFSKF------------------
-------------------------NIHVALLIGATTPSEKEKIKSGLRNGQIDVVIGTH
ALIQEDVHFKNLGLVIIDEQHRFGVKQREALMNK--------------------------
--------------------------GK--MVDTLVMSATPIPRSMALAFYGDLDVTVID
EMPPGRKEVQTMLVPMDRV----NEIYEFVRQEV-MKGGQAFIVYPLIEESDK---L---
-NVK-------------SAVEMYEYLSKEVFPEFKLGLMHGRLSQEEKDRVMLEFAEGRY
DILVSTMVIEVGIDVPRANVMVIENPERFGLAQLHQLRGRVGRGGQEAYCFLVVG-----
---DVGEEAMERLRFFTLNTDGFKIAEYDLKTRGPGEFFGVKQHG-LS-GFKVADLYR--
DLKLLEWAREDVQEIDVE-GIEL--PEEIKL---------------IEVG--------
>gi|15607024|ref|NP_214406.1|	   792 residues, 50 /line  ATP-dependent DNA helicase RecG [Aquifex aeolicus VF5]
-MD------------------TAFVKDFIDNLLENDGLKLKRA---------IGVGIFLF
NKLK----------EDAPD---YILESLKEVDKLPFEKKKAVLREVRKFL-SEYEKRKKE
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------GNFLEKTKRKPIDVFFNPI
EKV-KILT-KTQISTLKA-LGIETVY-----DALFYFPEKYEDKRLNTS---IKTAKVGE
KVALKVKVKEVKI------KE---------NERY----TL-EVVCTDGT-----------
----------G-Y--ITLKYRYK----NPH----FALK--AFRKGMEIVVYGKLKSFK-G
EKYM--VHPEVK---------------------------SPSSEELGKIIPVYYVRKRGE
LQEISSK--TKQKRVRTALTALSESLYRYFP-EYM------PDYLIEKYNFPDIALCIKE
LHNPKDIS-VNALNSFTDLYHKRVIYDELFLFQLALLL-KKQEIK-----------KEKA
PKV-----NVD-EKFLRKAIEKLPFKLTRAQERAIKEILEDLSRDVPMNRLLQGDVGSGK
TIVAILTSLAVVKSGYQVAVMVPTEILAHQHYKKFSEMLKDY------------------
-------------------------GVNVALLTGSLTPSQKKSVYKHVKEGNIHVLVGTH
ALIQDKVEFKNLGYVIIDEQHRFGVMQRKLLLEK--------------------------
--------------------------GKGLYPHCLVMSATPIPRTLALSIYGDLDISIID
ELPPGRKEVITKLYFESQK----EEVYKKVEEEL-KKGNKVYVIYPLIEESEK---L---
-NLK-------------AATEEYERWK-KLFPDRKVLLLHGKMPDKEKLAVMEEFKR-EG
DILVSTTVIEVGIDVPEATVMVIEDAHRFGLSQLHQLRGRVGRSDKEAYCLLVVPDEI--
--KNEKNESLKRLRVFVKTTDGFKIAEEDLKLRGPGEIIGVSQSG-YF-GFRVANLARSQ
DRALLGVARKDAEELLKN-NPNLENLQ--DLKKLLIKK-YGDKMELSFVA--------
>gi|15806915|ref|NP_295639.1|	   784 residues, 50 /line  DNA helicase RecG [Deinococcus radiodurans R1]
-----------------MSE-MATVAELQERLRRPLAAELAGGCHDR--VVAGGVEKLLS
T-----PLAG---------PFPKVREVLSGYAGLDESARAVALREALTLL-GSTGKTTRR
AAAPA-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------PTKMAP
PQAA--------------------------------------------------------
-----------------------------------------------PGERL--PLDAPA
ER--LNTG-PGGARKLST-LGLHTLR-----DVLHAYPHRHEDRRALPD---LADVEEGQ
KVTVMGTVVSKFR------RAPR-------PGML----IL-EIVLETPS-----------
----------GGR--VKATWF------NQP----WVEK--QLREGARLVLTGRAKKFG-R
QTQL--SVEHMETVDKA-----------------------EGSLSTRRIVGVYDAK----
-----EG--ISQEFLRKAAYKALEAA--PLD-DYL------PAHWRRKYGLTDLGDALWG
IHFPRDEAQ-------LARAHGRLRFDEYLFLELRMLL-QGEDAV------------LQG
KRF-----EAR-GEDINKFEAALPFRFTNAQRRVLLEITDDMRSDQQMARLVQGDVGSGK
TAVAACALYLAVRDGYQGALMAPTEILARQHYANLCGYLGQL------------------
-------------------------DVRVGLLIGAMTPKAKLEMQTRIAEGDVDVVVGTQ
ALIQENVQFDNLGLAVVDEEHRFGVQQRRRLLAS--------------------------
------------------------------RPDVLVMSATPIPRSLALTAYGDLELSIID
ELPPGRTPIETKLIQDTAR----QQAYGFVMGQI-RQGRQAYVVTALIEENEN---L---
-ELL-------------AATQLADDLK-TILPEARIDLLHGKMSAAEKDYVMERFRAHEF
DILVSTTVIEVGVDVPNSTVMVIENAERFGLAQLHQLRGRVGRGSLQSYCVMIAG-----
---ETSLKTRKRLKIIEGSTDGFVIAEADLKLRGPGEIRGTRQSG-IP-DLRLADLAN--
DADIIEQARELAKHILAN-DPRLEHPRLQYLRSELQNR--SSSVAYREVI--------
>gi|16331409|ref|NP_442137.1|	   831 residues, 50 /line  DNA recombinase [Synechocystis sp. PCC 6803]
--------------MQCSLV-EVSVSVDWPRLQKALTVEVERGFQNLQG-KQHRFGDFLC
LSFGSPPPPGSS--PGDRQKWREFAQRFAQYDQLEEAERKSLVASTRRFL-HQLRRSLES
PPRD--------------------------------------------------------
----------------SVPKKDLLA-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------QVNRPQVSEPRYPKSGQI--ELHTPL
ATV-VSQS-QHQTKLLKN-LGLATVE-----DLLFYFPRDYLDYAQQVT---IAELTAGE
TVTIVGRVVNCTC------FTSP-----KNQNLN----IL-QIQLRDQT-----------
----------G-R--IKLSRFYAGKRFAHRGWQEKIKK--LYPPQAVVAASGLVKSSK-F
GLTL--DNPEIEVLDRH----------------SP----SIDSFKVGRVLPVYPLT----
-----EG--ITADFLRKLVLACQTAIA-KLS-DPL------PQEIREKYELIDLQTAIAQ
IHFPENTEK-------LSLARRRLVFDEFFYLQLGFLQ-RRYEQK-----------QQQQ
SAI----FTPH-GELLEKFSDLLPFRLTQAQQRVVNEILQDLNKPSPMNRLVQGDVGSGK
TVVGVFAILAALQGGYQAALMAPTEVLAEQHYQKLVSWFNLL------------------
-------------------------YLPVELLTGSTKTAKRREIHAQLSTGQLPLLVGTH
ALIQETVNFQRLGLVVIDEQHRFGVQQRAKLLAK--------------------------
--------------------------GN--APHVLSMTATPIPRTLALTLHGDLEVSQID
ELPPGRQPIHTSVITAKER----PQMYELIRREV-AQGRQVYIIFPAIEESEK---L---
-DIK-------------AAVEEHKYLTEKIFPNFNIGLLHGRLKSAEKEAALTAFREKQT
EIIVSTTVIEVGVDVPNATVMVIENAERFGLSQLHQLRGRVGRGSHQSYCLLVTNS----
----KSNDARQRLGVMEQSQDGFFIAEMDLRLRGPGEFLGTKQSG-LP-DFALASLVE--
DQEVLLLAREAAETMMVE-DPNLEA--HPDLKIKLVQR-YEKLLGGEILT--------
>gi|27262498|gb|AAN87530.1|	   807 residues, 50 /line  ATP-dependent DNA helicase recG [Heliobacillus mobilis]
----------------------MSWQPLWQSLRRAIDAERNLGYTDG--GVVGGFSAYAH
ASLAALRQALSAHPGPWGARMALWEGQMIHYRRLTPPERRHVVDQMAQSI-GELELELP-
------------------------------------------------------------
-----------TAEATKQVSSNPGS-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------DDKTVNKKQPERPSRNLK--GPGTAI
QFL-RGVG-PQRAAALKR-LGIETIQ-----DLLFHLPHRYIDRSQLLS---IAQIRYPG
DYNVSGVIRAYQQ------YNPR-------RGLA----VI-KGQLDDGT-----------
----------G-I--LPIVLF------NRK----QLTA--KYPPGTAVIVSGKVEFR-YG
KAEL--HVEEIENQ-------------------------AEAGLHTNRIVPVYPAT----
-----EG--LNQRFLRGLYEQVIPKYAPQMN-DIV------PKGLDRSTNLPALSQAVQW
VHFPDSLEQ-------AELGRRKLAFNEAFLLQTAWQFIRRRRNV-----------PIEG
IGH-----KPA-QEELNKLWSLLPYELTAAQKRVVREIAADMEANRPMNRLLQGDVGAGK
TIVAASAVVKAVASGYQAALMAPTEVLAEQHAISWQRLLAEM------------------
-------------------------AIPVAHLSGSLTRRRKEEVLKGLSEGTYPVVVGTH
ALLQKEVVFQRLGLVVIDEQHRFGVRQRAALWEK--------------------------
--------------------------GQ--QADLLVMTATPIPRTLAMTLYGDLDVSILN
ERPPGRQEVKTYHVGSDTW----PRVYNLIRREV-SQGHQAYIVCPAIEESEE---M---
-DLA-------------AVEERYGTLTRDVFPDLEVGILHGRMKKEEKAAVMERFYRGNT
KVLVATTVIEVGIDVPAATVMVIEGAERFGLAQLHQLRGRVGRGQAQSFCILIAD-----
---KLSDEGKRRMSAMEGTNDGFRLAEEDLKLRGPGEFLGTRQSG-IP-AFKVADLVK--
DADLLDQAKSASEQWNAQ-DPTLQRPESRELARKVRET-----FQGLDLL--------
>gi|33240278|ref|NP_875220.1|	   841 residues, 50 /line  RecG-like helicase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
MVEQYKDRKKQ-NSLELRDQQINALNNWVRLLQKALTVEAENGFKNIHG-RAEHFNSFLS
REIKEFKSPLLS--NEIDKKLTLFAKSFDDYPTSDLPIKRRLIIDARQLL-YRLSKEYQI
KDIPSPP-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------KLRMS
DSQSTANDI---------------------------------------------------
------------------------------------------------RQHL--RIDSPL
GEV-KGVG-TKMCECFAA-LNLFVIK-----DLLFHYPRDYVDYSSLKR---IFSLVPGE
TTTIIATIRRSNS------YTSP-----RNQNLS----IL-ELHLEDMT-----------
----------G-R--IKISKFFIGRRFSKRSFLKKQES--LYPKGTIVAVSGLVKGNS-Y
GKSF--NDPLIEVLEHK----------------QA----LLKSQTIGRILPIYQLT----
-----DG--LKADRLRQIVHSVIPLA-LDLE-DPL------PVNTRESLSLLDKGEAIKQ
IHRPRNQEY-------LKKAKRRLVFDEFLFLQLGLLK-RRLELG-----------KCKA
PSL--FINKER-EGFTEQFLKLLPFALTNSQQQVLTQIESDIAMSKPMSRLVQGDVGCGK
TVVAIAALLRAVESGWQGAFMAPTEVLAQQHYLTLCKWLPQL------------------
-------------------------HVTVELLTGSTAAKERKRIFADLSNGNLKIIVGTH
ALIEESVSFRRLGLVVVDEQHRFGVNQRNLLLNK--------------------------
--------------------------GL--HPHLLTMTATPIPRTLALSIHGDLDVSQIN
ELPPGRTPIETQLMPSSER----YQAYEAIKEQL-DIGSQAYVVLPLVDESEK---L---
-ELR-------------SAIDVYHELSSEILSEYKVGLLHGRMHSSEKKGIINKFVNKEI
EVLVSTTVVEVGVDVPEATMMVIDHADRFGLAQLHQLRGRVGRGTKDSKCILIDTA----
----KSLASKNRLEVLVNSHDGFEISEIDLRLRGPGQVLGTRQSG-LP-DFALANLVN--
DETILESAREEAEKILKS-DPDLIQ--NKLLKIMLDDY-WNRLVTKTQLN--------
>gi|46199206|ref|YP_004873.1|	   770 residues, 50 /line  DNA helicase recG [Thermus thermophilus HB27]
------------------ME-GVTQEELKARLLKPLLRELQDGARDR--VVVGGLEALVQ
NLAR---------------PFPKLLELFRGYGEKPQEERKRVLQEALRLL-EGQGPS---
------------------------------------------------------------
------------PKGQAQASSRRL------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------APSDPA
HLL---AP-PQSRRKLAE-LGLRTVR-----DVLHHYPRRYEDRRTLPG---ARYLEEGQ
KATLAVKVLAKEL------VKTP------RKGMQ----LV-QVKAQDAW-----------
----------GWR--ITLVWF------NQP----WVLS--QIEEGATLIVTGRVGRR-NG
L-QL--YVEHFE---DE----------------------GTESLSTGRIVPIYPAK----
-----EG--VSQAFLRRTVHRALELAL-PLP-DPL-------EAYREDLGLMPYAEALKA
IHFPEDEEA-------LKRALLRLKFDEYLLLELKALL-EAGGMV-------------LG
RSF-----RVE-EAWVEAFKKALPFPLTRAQERVMGEIAKDMQSPRQMARLLQGDVGSGK
TVVAAFALFLAAKNGAQGALMAPTEILARQHYQNLTRYLFPL------------------
-------------------------GIRVELLLGSMTAKEKEAAMARLLSGEAQVAVGTH
ALIQEGVGFRDLGLAVVDEEHRFGVLQRRALLKL--------------------------
--------------------------AK-APPDVLVMSATPIPRSLALTLYGDLEVSVLD
EMPPGRVPVKTKVLPHRLR----LQAYAFAREEV-RKGHQVFVVAPAIEESEE---L---
-DLK-------------AATTLYEELK-GLLPGVRLALLHGRMPAREKDEVMEAFRRGDY
DLLVSTTVVEVGVDIPKATLIIVENAERFGLAQLHQLRGRVGRGGLQGYAIFIAG-----
---EAGQKTLKRLKILEESTDGFYIAEMDLKLRGPGELRGTRQSG-YP-ELKLGDLAE--
DTGIIEKARALAKAIVDK-DPTLDLPEHRALKEELRAQ--AERVGFREVI--------
>gi|78212756|ref|YP_381535.1|	   812 residues, 50 /line  ATP-dependent DNA helicase RecG [Synechococcus sp. CC9605]
----------------------------MLPIQRSLGLEADRGFQNLQG-RQQRFHAFLQ
QQLAAPPALPFP--QEVSERMSKLSSGFADYPNLADPARRRLVTDARQWL-HELRHRLEP
SAPMAPP-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------RLKVQASPQQRTSSPL--QLDSPI
TQI-RGVG-PKFAARLAS-IGLLLVR-----DLLRYYPRDHVDYSAMRR---IEALVSGE
TATIVATIRRCNG------FVSP-----RNTNLA----II-ELQLQDPT-----------
----------G-R--LKVSRFLAGKRFSSPAYLKGQQR--LYPVGATVAVSGLVKDGP-Y
GITF--QDPLIEVLDSP----------------SS----PVKSPSIGRLLPVYPLT----
-----EG--VGADRFRSLIDQVLPLA-ASWP-DPL------PALLQRQFQLPALSDSLQA
LHAPKDRES-------LDQGRRRLVFDEFLLMQLGLLR-RRQALR-----------SRTG
PDLD--LQSSS-SGLVGEFMDLLPFRFTAAQQRVFQEIEVDLARSEPMARLVQGDVGSGK
TVVAIAALLSTIASGWQGALMAPTEVLAEQHYRNLCQWLPQL------------------
-------------------------HVSVALLTGSTPRPRRRELLDDLANGSLKVLVGTH
ALLEDPVVFNRLGLVVVDEQHRFGVHQRDRLLNK--------------------------
--------------------------GL--QPHLLTMTATPIPRTLALSMHGDLDVSQID
ELPPGRTPIRTRMLTAAKR----EKAYELIREEV-QLGQRAYVVLPLVDESEK---L---
-ELR-------------SAVEVHAELASEVFPDLAVGLLHGRLSSADKQAVLTDFSAGKT
QVLVSTTVVEVGVDVPEASVMVIDHAERFGLAQLHQLRGRVGRGAAASHCLLING-----
---SSNPLARQRLDVLVRSTDGFEIAEMDLRLRGPGQVLGTRQSG-LP-DLALASLAD--
DGAVLEDARTAAQELLKT-DPELEQ--HPLLRETLDAQ-QRRLSGGTPLN--------
>gi|86158152|ref|YP_464937.1|	   772 residues, 50 /line  ATP-dependent DNA helicase RecG [Anaeromyxobacter dehalogenans 2CP-C]
-------------------------------MPPPPVAKASPPVAES--APRASITKPAP
------------------------------------------------------------
------------------------------------------------------------
---------RPTREPAPRASTREP------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------APVAEPA
PRAPLPPDPPWHP-----------------------------------------------
-------------------------------------LPDARTAEERAARRR--RLATRL
ADL-PRVH-PAPRALLEE-RGRETVE-----AALELWPRAYQDRTALRR---ISELRVGD
EATVLGTVAHVRI------QRMR-------SGKP----LL-KVGVQEGG-----------
----------S-A--LELVFF------NPPP---WRLK--QFAAGESLLCSGKVTEGFGA
RRQM--SQPEVEKVQ------------------------AGDSANFGRIVPVYPGP----
-----AD--YQHPALRKLMKRLVDELVPAAV-DDL------PADLRARRELVGRAEALRE
AHFPPPGTDPLRAAERVTPAFRRLVFEELFFLQLALAM-RRRGVR-----------AEAG
IAF-----DAS-PAALARAVEPLPFRLTGAQERALAEIARDMAEPEPMNRLLQGDVGSGK
TAVAFAAMMLAVRSGWQAALMVPTEILAGQHARTLSRWLEGR------------------
-------------------------GVEVALVGASARGKGQREARAAVAEGRARIAVGTH
ALLEQAVGFERLGLVVVDEQHRFGVMQRASLISK--------------------------
--------------------------GR--RPDVLVMTATPIPRTLALAFYGDLDQSKIG
ELPPGRTPVTTRLFGDSQR----KAAYALARGEL-EAGRQVYVVYPLVEESEK---T---
-DLA-------------DATTGATELA-KVFPGHEIGLLHGRMKPDEKQRVMDRFRAGEL
QVLVATTVIEVGVDVPNASVMIVEHAERFGLSQLHQLRGRVGRGAAKSFCLLLAHF----
--RRAGDEARERLRAMEETQDGFEIARVDLRIRGPGELLGTRQSG-QK-LLDVADLYR--
DEAILEEAREEAFGLVER-DPDLARPEHAAAREALAGR-WAGRLSLAQVG--------
>gi|94971548|ref|YP_593596.1|	   753 residues, 50 /line  ATP-dependent DNA helicase RecG [Acidobacteria bacterium Ellin345]
-------------------------------MPSTTAANAFNHLRST--SYWKTWH----
-------------------------------------VAGLLRGATFVF-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------VL--DLSTSV
QYV-KGIG-PRTAETLAT-KGISTVE-----DLLYYLPFRYEDRLNPRG---IGELRPGE
MASVVAEVRTSGL------FRTR-------AG-P----MF-QLTVGQGH-----------
----------Q-T--LKCLWF------HGA----YLKD--RFKPGQLLAMYGKVEESKFG
RRELQIIQPQFEVLHDPD--------EPAEDADSGKL----KTLEIGRIVPIYETA----
-----GNGKLTSKYFRRVIYGALENLTDEIP-DPI------PPVTRSHVDLLERRAAFSK
AHWPDEGESFTRLQSARSAAHIRLIFEELFFLELGLEL-KRRKMR-----------AQAG
IPF-----RVD-DQVREAIKRILPFHPTAAQKRVLGEIVADMKQPSPMRRLLQGDVGSGK
TIVAFEAAVIAIENGYQVALMAPTEILATQHYLSARRILEGA------------------
-------------------------GYRIVLLTGSVEQDRKREIRRHIAQGNAQLVIGTH
ALIQEGVEFDALGLVIVDEQHRFGVMQRFKLMKK--------------------------
--------------------------TDAAEPDVLVMTATPIPRTLALTLYGDLDVSILN
ELPPGRTPIVTRRVSDERA----DEVWAFVRKQI-AAGHQAYIVYPVIEENED---AESG
KQLK-------------AAMKMYDELRKNVFADLRVGLLHGRMDSDDKDAVMRRFQAGDV
QVLVSTTVIEVGVDVPNANIMVVEHAERFGLSQMHQLRGRIGRGSAKSFCVLMTGG----
---KVSPEAEQRLDAMVSTNDGFQISELDLQLRGPGEFFGTKQAG-MP-DFRVANLLR--
DRELLELAKREAAYVTSGPHPDLSEAEIKNVLTHLRTH-WNRRYGLVEVG--------
>gi|88936064|ref|ZP_01141683.1|	   829 residues, 50 /line  ATP-dependent DNA helicase RecG:Transcriptional regulator AbrB [Geobacter uraniumreducens Rf4]
-MSNLHCQE------------LPCSAHVKTTMI--YVYLLNKGGARC--EAAGPVRPFIF
PLTESDSRCY-----STCAAMFEAAATAMTIIKLSEDNRISLPLEVTEALGLKPGDAVEL
TASENGFLLAR-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------HTPASPAPLRESVSRK--NLETPM
QFI-KGVG-PKLAENLAK-KGVSVVE-----DALFLLPHRYEDRRTLAK---IGRLRPGA
NEVFFAEVIAADA------ASTR-------GGKR----FF-EVTVGDGS-----------
----------G-T--VTLKWFHFNPA--------FMKK--IWKPGRKGIFTGEVVQYG-F
QREV--HHPEVEWLPEGE------------DLAAVMAG---DPLSFGRILPVYPLT----
-----EG--LSQKTLRKVMKEAVDRFVADVE-NHL------PLEVIGRHDLMPLDKALQA
AHFPANDADLQTLNNGATAAHRTLAFDEFFFLELGLAL-KKNGIA-----------LEEG
IDF-----QVT-HKYTKELLKLLPFSLTNAQRRVLSEIKNDMMAPHPMHRLVQGDVGCGK
TLVALMAALVAVENDYQVAIMAPTEILAEQHFLNIHHWCDAL------------------
-------------------------GVKVALLTSSLKGKAKKAALEEIATGNAQVVIGTH
AVIQDKVEFRRLGLGIIDEQHRFGVLQRGILKKK--------------------------
--------------------------GQ--NPDILVMTATPIPRTLAMTVFGDLSLSVID
ELPPGRTPVETRIAFESRR----SQVYGVIREEV-KKGRQAYVIYPLVEESEK---S---
-DLK-------------AAAQMAEQLQSDVFPDLRVGLLHGRMRPDEKEAVMAAFKARET
DILVATTVIEVGIDVPNATVMVIEHAERFGLSQLHQLRGRVGRGSDKSRCILLTTG----
---RLSEDGEKRLRVMESTSDGFRIAEADLEIRGPGDFLGTRQAG-LP-DFRVANILR--
DGRILEEARMEAFSFVEK-DRGLVAPENAGLRRELARR-WGGRLELAGIA--------


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.