Fandom

Proteins Wiki

At2g01440.1

47,922pages on
this wiki
Add New Page
Talk0 Share

In the plant Arabidopsis thaliana, At2g01440.1 is a gene model for the locus At2g01440.[1]

This gene model is classified by TAIR as "ATP-dependent DNA helicase, putative". It is located on chr2, region 194093-199055 REVERSE.

Physiological functionEdit

At2g01440.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g01440.1/Expression

Subcellular localizationEdit

At2g01440.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g01440.1 has 953 amino-acid residues and a molecular weight Mw = 106.254 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is 1.77, or 0.002 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g01440.1/Knockout

Protein interactionsEdit

At2g01440.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g01440.1 has 2 recognized domains:

  • Domain_0523_0715 DEAD domain (PF00270, IPR011545) Description: DEAD/DEAH box helicase, N-terminal;Molecular Function: nucleic acid binding (GO:0003676), Molecular Function: helicase activity (GO:0004386), Molecular Function: ATP binding (GO:0005524)
  • Domain_0791_0868 Helicase_C domain (PF00271, IPR001650) Description: Helicase, C-terminal;Molecular Function: nucleic acid binding (GO:0003676), Molecular Function: helicase activity (GO:0004386), Molecular Function: ATP binding (GO:0005524)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g01440.1
MAAVTLSPCS MCCGSRRLRS VIVIQAQRGN WNRIRLSNFF FSKVWNISYR SKHKYSDNLL EQVEKYASAR LENQSKLITK VAALMECDNV DDFIDKKSDE QVKKDLVLAC KRFPSIILGD SRPVELYSNS KSYGESSSIL KTPTDNSFLP TPMHGGWFDP DNLSRTLSSF CPELLQNDDS SDPREDILDD GSSFTSKTAT SEVEATSDDV FAAQRFLATS IDSMPGLSKR HSNQLDSCGF HTMKKLLHHF PRTYADLQNA QVDIEDGQYL IFVGKVLSSK GVRASSSFSF LEVIVSCEVS GRDRTPEDLS HNAEDKAGKS IFLHLKKFFR GTRFTWQPFL NSIQEKHKVG DLVCISGKVK SLRAEDHFEM REYNIDVLKD EEESSHRAQG RPYPIYPSKG GLNPKFLSDV ISRALRVLPA NMDPIPKEIT KVFGLPSLND AYVGIHEPKT LDEADLARKR LIFDEFFYLQ LARLYQMLQS LGTKIEKDVL LEKFRKPVLN SVYIEEWSTL TKSFLKALPY SLTPSQLSAV SEIIWDLKRP VPMNRLLQGD VGCGKTVVAF LACMEVIGSG YQAAFMAPTE LLAIQHYEQC RDLLENMEGV SSKPTIGLLT GSTPAKQSRM IRQDLQSGAI SFIIGTHSLI AEKIEYSALR IAVVDEQQRF GVIQRGKFNS KLYGTSMISK SGSSDSDDTS KADLSMAPHV LAMSATPIPR SLALALYGDI SLTQITGMPL GRIPVETHIF EGNETGIKEV YSMMLEDLKS GGRVYVVYPV IDQSEQLPQL RAASAELEIV TKKFPKYNCG LLHGRMKSDD KEEALNKFRS GETQILLSTQ VIEIGVDVPD ASMMVVMNAE RFGIAQLHQL RGRVGRGTRK SKCLLVGSST NSLKRLNMLG KSSDGFYLAN IDLLLRGPGD LLGKKQSGHL PEFPVARLEI DGNMLQEAHI AALVYIHSPM TLQ
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.