FANDOM


>gi|18379213|ref|NP_565260.1|	 unknown protein [Arabidopsis thaliana]
MARSCSIWTPVLISLSPVTGESPKISRRRVILATSIGSPQPLLE--AKIKEPQKLQVLDS
KDVSRRNTMLYLAAGFLGGINFLNGEAAEARVGRKENRKKALEKL-RAKAKESEPNNKSG
NQKIEKELEKEEVFPLLPPPLVVEANLLQ
>gi|115438833|ref|NP_001043696.1|	 Os01g0644000 [Oryza sativa (japonica cultivar-group)]
MVITALQLLPPILGLPATARNGYAVRRPRMMTVTCCRH-----NQATTVHESRLTSSLSR
RDA-----LSYMSSAFIA--TLLVAGPAEARTSRQENKRKVREKLEKLREKALGPDDKNG
AIR-----KKESLANLLIPPKLVEATI--
>gi|125527036|gb|EAY75150.1|	 hypothetical protein OsI_002997 [Oryza sativa (indica cultivar-group)]
-MQKCEENKQSGSSVALVFYGTTTIHHQRHLPSSQVPSSRNNGNHGSAASPSNPWPSGDG
EKW-----LRRQKATDDD--CDLLQAQPEARTSRQENKRKVREKLEKLREKALGPDDKNG
AIR-----KKESLANLLIPPKLVEATI--
>gi|21592463|gb|AAM64414.1|	 unknown [Arabidopsis thaliana]
MARSCSIWTPVLISLSPVTGESPKISRRRVILATSIGSPQPLLE--AKIKEPQKLQVLDS
KDVSRRNTMLYLAAGFLGGINILNSEAAEARVGRKENRKKALEKL-RAKAKESEPNNKSG
NQKIEKELEKEEVFPLLPPPLVVEANLLQ