FANDOM


>gi|42568859|ref|NP_178248.2|	   577 residues, 50 /line  577 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
----------MRFSSIFRNTPIQF--SNRRSSVKLLHSLPRLKP----------------
-----------------------TNSKR--------------------------------
-----------------------FSQKPKLVKTQTLPDP---SVYTR-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------DIVSNIYNILKYS----------
---------NWDSAQEQLP-HLG--VRWDSHIINRVLKAHPP------MQK--AWLFFNW
AAQIKGFKHDHF--TYTTMLDIFGEAGR-IQSMYSVF-HLMKE-KG-VLIDTVTYTSLIH
WVSSSGDVDGAMRLWEEMRDNG-----C-EPTVVSYTAYMKM-----------LFA-DGR
VEEATEVYKEMLR--SRVSPNCHTYTVLMEYLVATGKCEEALDIF-FKMQEIGVQPDKAA
CNILIAKALKFGET-------------------------------------------SFM
TRVLVYMKENGVVLRYPIFVEALETLKAAGESDDLLREVNSHISVESLCSSDIDETPTAE
VNDTKNSDDSRVISSVLLMKQNLVAVDILLNQMRDRNIKLDSFVVSAIIETNCDRCRTEG
ASLAFDYSLEMGIHLKKSAYLALIGNFLRSNELPKVIEVVKEMVKA---Q-HSLGCYQG-
------AMLIHRLGFGRRPRL---AADVFDLLPDD--QKGVAAYTALMDVYISAGSPEKA
MKILREMR---EREIMPSLGTYDVLLSGLEKTSDF--QKEVAL------------LRKEK
KSLV-ASARFRENVHVEDKICDLLF------------------ATNL-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------L
>gi|20219038|gb|AAM15782.1|AC104428_3	   648 residues, 50 /line  648 residues, 50 /line  Putative indole-3-acetate beta-glucosyltransferase [Oryza sativa (japonica cultivar-group)]
--------MAIPRRLAAAAAAETTKRSAAGLAAALG--------GSGGKPATADLAAAAT
AAAA----------------------------------------------AGRASECQSL
LLRMSRR-------------------------------------RGACRREI-VSSLLGS
SP--TPQPRVFDLLI-RTYTQSR---KPREAFEAFRLILDHRV-----------------
-----------------------PIPAAASNALLAALSRAGWPHLAADAYRLVFSSN-SE
--V-NTYTLNIMVHNYCKA-LEFDKVD---A---VISEME---K-RCVFPDVVTHNVMVD
ARFRAGDAEAAMAL-VDSMVSKG-LK----PGIVTYNSVLKGLCRSGMWD----------
---------KAWEVFKEMD-DFG--VAPDVRSFTILIGGFCRVG---EIEE--ALKIYKE
M-RHRGIKPDLV--SFSCLIGLFARRGK-MDHAMAYL-REMRC-FG-LVPDGVIYTMVIG
GFCRAGLMSDALRVRDEMVGCG-----C-LPDVVTYNTLLNG-----------LCK-ERR
LLDAEGLLNEMRE--RGVPPDLCTFTTLIHGYCIEGKLDKALQLF-DTMLNQRLRPDIVT
YNTLIDGMCRQGDL-------------------------------------------DKA
NDLWDDMHSREIF-----------------------------------------------
------------------------------------------------------------
--------------PNHVTYSILIDSHCEKGQVEDAFGFLDEMINK---G-ILPNIMTY-
------NSIIKGYCRSGNVSK---GQKFLQKMMVNKVSPDLITYNTLIHGYIKEDKMHDA
FKLLNMME---KEKVQPDVVTYNMLINGFSVHGNV--QEAGWI------------FEKMC
A-KG-IEPDRYTYMSMINGHVTAGN------------------SKEAFQLHDEMLQRGF-
APDD--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------KF
>gi|22330179|ref|NP_683419.1|	   650 residues, 50 /line  650 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
MKLLRRRFFN------SVNTITRP-------NRRHYATKYVAKVTSSSPSGRSLS--AEV
SLPNPLPADVRGYPLPRRH---------------LICR--------ATNLITGASNLSDA
--FSDLSDY----------LSSLSLSLTPDEASEILKSL---NSPLLAVEFF-KLVPSLC
PYS-QNDPFLYNRII-LILSRSNLPDRFDRVRSILDSMVKSNV-----------------
-----------------------HGNISTVNILIGFFGNTEDLQMC---LRLVKKWD-LK
--M-NSFTYKCLLQAYLRS-RDYSKAF---D---VYCEIR---R-GGHKLDIFAYNMLLD
ALAKD---EKACQV-FEDMKKRH-CR----RDEYTYTIMIRTMGRIGKCD----------
---------EAVGLFNEMI-TEG--LTLNVVGYNTLMQVLAKGK---MVDK--AIQVFSR
M-VETGCRPNEY--TYSLLLNLLVAEGQ-LVRLDGVV--EISK-RY-MTQGI--YSYLVR
TLSKLGHVSEAHRLFCDMWSFP-----V-KGERDSYMSMLES-----------LCG-AGK
TIEAIEMLSKIHE--KGVVTDTMMYNTVFSALGKLKQISHIHDLF-EKMKKDGPSPDIFT
YNILIASFGRVGEV-------------------------------------------DEA
INIFEELERSDCK-----------------------------------------------
------------------------------------------------------------
--------------PDIISYNSLINCLGKNGDVDEAHVRFKEMQEK---G-LNPDVVTY-
------STLMECFGKTERVEM---AYSLFEEMLVKGCQPNIVTYNILLDCLEKNGRTAEA
VDLYSKMK---QQGLTPDSITYTVLER---------------------------------
-------------------LQSVSH------------------GKSRIRRKNPITGWVV-
---S--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------PL
>gi|28393724|gb|AAO42273.1|	   642 residues, 50 /line  642 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------MMYVSARSGSAKRSISSLP--------HLSQRFKQTENEIVQM
FSVPNHEESE---KPQE-KWKLSRKDPSVRMLDERFIR--------IVKIFKWGPDAEKA
LE-------------------VLKLKVDHRLVRSILEID---VEINVKIQFF-KWAGKRR
NF--QHDCSTYM------------------------------------------------
-------------------------------TLIRCLEEARLYGEMYRTIQEVVRNTYVS
--V-SPAVLSELVKALGRA-KMVSKAL---S---VFYQAK---G-RKCKPTSSTYNSVIL
MLMQEGQHEKVHEV-YTEMCNEGDCF----PDTITYSALISSYEKLGRND----------
---------SAIRLFDEMK-DNC--MQPTEKIYTTLLGIYFKVG---KVEK--ALDLFEE
M-KRAGCSPTVY--TYTELIKGLGKAGR-VDEAYGFY-KDMLR-DG-LTPDVVFLNNLMN
ILGKVGRVEELTNVFSEMGMWR-----C-TPTVVSYNTVIKA-----------LFESKAH
VSEVSSWFDKMKA--DSVSPSEFTYSILIDGYCKTNRVEKALLLL-EEMDEKGFPPCPAA
YCSLINALGKAKRY-------------------------------------------EAA
DELFKELKENFGN-----------------------------------------------
------------------------------------------------------------
--------------VSSRVYAVMIKHFGKCGKLSEAVDLFNEMKNQ---G-SGPDVYAY-
------NALMSGMVKAGMINE---ANSLLRKMEENGCRADINSHNIILNGFARTGVPRRA
IEMFETIK---HSGIKPDGVTYNTLLGCFAHAGMF--EEAARM------------MREMK
D-KG-FEYDAITYSSILDAVGNVDH------------------EKDDVSS----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------F
>gi|3289002|gb|AAC25599.1|	   668 residues, 50 /line  668 residues, 50 /line  CRP1 [Zea mays]
MPASLLPPTFLPHHLRRLAPAGCTTSSVTSSSVSIPASRYDFEPLLAYLSSPSVS---AS
LTSPSPPASV---PAPEHRLAASYSAVPSHEWHALLRD--------LAASDVSLPLAFAL
LPFLHRHRLCFPLDLL-LSSLLHSLSVSGRLL---------------PHSLL-LSFPPSL
SD--PPSPLLLN------------------------------------------------
-------------------------------SLLAASAAASRPAVALRLLSLLREHD-FL
--P-DLASYSHLLASLLNT-RDPPDAALLER---LLGDLR---E-SRLEPDAPLFSDLIS
AFARAALPDAALEL-LASAQAIG-LT----PRSNAVTALISALGTAGRVA----------
---------EAEALFLEFF-LAGE-IKPRTRAYNALLKGYVRIG---SLKN--AEQVLDE
M-SQCGVAPDEA--TYSLLVDAYTRAGR-WESARILL-KEMEA-DG-VKPSSYVFSRILA
GFRDRGDWQKAFAVLREMQASG-----V-RPDRHFYNVMIDT-----------FGK-YNC
LGHAMDAFNKMRE--EGIEPDVVTWNTLIDAHCKGGRHDRAAELF-EEMRESNCPPGTTT
YNIMINLLGEQEHW-------------------------------------------EGV
EAMLSEMKEQGLV-----------------------------------------------
------------------------------------------------------------
--------------PNIITYTTLVDVYGRSGRYKEAIDCIEAMKAD---G-LKPSPTMY-
------HALVNAYAQRGLADH---ALNVVKAMKADGLEVSILVLNSLINAFGEDRRVVEA
FSVLQFMR---ENGLRPDVITYTTLMKALIRVEQF--DKVPVI------------YEEMI
T-SG-CAPDRKARAMLRSGLKYIKH------------------MR---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------VA
>gi|8493575|gb|AAF75798.1|AC011000_1	   514 residues, 50 /line  514 residues, 50 /line  Contains multiple PPR Repeats PF|01535. [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MVETG-CP
--A-NVVTFTTLMNGLCRE-GRVLQAL---A---LVDRMV---E-EGHQPDAVTYGTIVN
GMCKLGDTVSALNM-LRKMDESQ-IK----ANVVIYSAIVDRLCKDGNHI----------
---------KAQNIFTEMH-EKG--IFPNVLTYNCMIDGYCSYG---KWSD--AEQLLRD
M-IERNIDPDVV--TFSALINAFVKEGK-VSGAEELY-REMLR-RN-IFPTTITYSSMID
GFCKHSRLEDAKHMFDLMVSKG-----C-SPDIITLNTLIDGCCRAKRHLIHGFCQ-VGN
VNVAQDLFQEMIS--NGVSPDIVTCNTLLAGLCENGKLEKALEMF-KVFQKSKMDLDTAT
CNIIINGMCKGNKV-------------------------------------------DEA
WDLFNSLPVNGVE-----------------------------------------------
------------------------------------------------------------
--------------TDVVTYNILIGVFVKEGNFLRAEDIYLEMLCK---G-IIPSTVTY-
------NSMVDGFCKQNRLEE---ARQMVDSMVSEGCSPDVVTFSTLIKGYCKAGRVDDG
LELFSEMC---QRGLVADTITYNALIHGFCKVGDL--NGAQDI------------FEEMV
S-SG-VCPDTITFRSMLAGLCTKAE------------------LQKGLTMLEDLQKSVDH
ELED--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------DE
>gi|91176409|gb|ABE26630.1|	   548 residues, 50 /line  548 residues, 50 /line  Tetratricopeptide-like helical [Medicago truncatula]
-----------------------------MSFS----AFRYVVI----------------
-----------------------SNFTPNPNFIGL-------------------------
----------FPSSIRLFSQLHHKQDEENN-----------------LISSF-NHLLLHK
NP--TPPTFQFN------------------------------------------------
-------------------------------KILSSLVKAKHHSTALSLHQQMELNG-IE
--S-DFFTFNILINCFSQL-GLNSLSF---S---IFAKIL---K-KGYHPTAITFNTLIK
GLCLKGHIHQALHF-HDKVVAQG-FH----LDQVSYGTLINGLCKVGRIT----------
---------AALQLLKRVD-GKL--VQPNAVMYNMIIDNMCKAK---LVND--AFDLYSQ
M-VAKRICPDVF--TYNALISGFSAVSK-LNYAIDLF-NKMKK-EN-INPNVYTFNILVD
GFCKEGKVNDAKVVLAIMMKDD-----I-KPDVVTYNSLMDG-----------YCS-INK
VNKAKDIFDSMAS--GGVIANVQIYTTMVNGFCKIKMVDEAINLF-EEMRCRKIIPNVVT
YSSLIDGLCKLGRI-------------------------------------------FYA
LKLVDEMHDRGQP-----------------------------------------------
------------------------------------------------------------
--------------PNIVTYSSILDALCKNHHVDKAIALLTNLKDQ---G-IRPDMYTY-
------TILIKGLCQSGRLED---AQNVFEDLLVKGYNLDVYAYTVMIQGFCDKGFFDKA
LALLSKME---DNGCIPNAKTYELVILSLFEKDEN--DTAEKL------------LREMI
V-RG-LL-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------
>gi|92872892|gb|ABE81424.1|	   554 residues, 50 /line  554 residues, 50 /line  Tetratricopeptide-like helical [Medicago truncatula]
---------------------------MSRMRVSKLHGFLQNLF----------------
-----------------------VPSKNIHS-----------------------------
---------------------------------QRVPSS---REYMR-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------NVIGNIYRTLKYS----------
---------SWDSAQQQLQ-NLP--LKWDSYTVNQVLKSHPP------MEK--AWLFFNW
ASRLKGFKHDQF--TYTTMLDIFGEAGR-ISSMKHVF-NQMHE-KG-IKIDSVTYTSMMH
WLSTSGNVDEAIALWDEMKSKG-----CCYPTVVSYTAFIKI-----------LFD-NHR
VKEATAIYKEMLH--NGCVPNCYTYTVLMDHLIASGKCKEALEIF-QKMQEAGVEPDKAA
CNILIDKCSKVCGT-------------------------------------------VFM
TKILQYMKENRLVLRYRVYVKAMEALKIAGESDTLLRQVNPHFYLDSSFKEKAHDRNTVI
ADSSSNIDKEL--LLVLLRNRNVVAIDHLIQGMMDKKISVDNKVISTIIEVNCNCCRPDG
ALLAFNYSVTMGISIERTGYLSLVGLLNRSNMFSKLVEIVGEMTRA---G-HSLGIYLA-
------SLLIYRLGCARQLSI---ALKIFNLLPDN--HKCVATYTALISIYFSARRVNKA
LEIYKIMC---QKGNCPTSGTFNILVAGLERNGRF--SEAGVH------------RKAKK
N-LN-SNIGSQENLSTEGRICDLLF------------------AGDVI------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------L
>gi|92877343|gb|ABE84479.1|	   583 residues, 50 /line  583 residues, 50 /line  Pentatricopeptide repeat [Medicago truncatula]
------------------------------MVTDKLTRSIQGPI----------------
-----------------------LQSLSIPTISEL-------------------------
----------LSKQHWSELKPHLRVTKPATFLDQLLNAG---VDSELVLRFF-KWSQKEY
RL--SYGLEPTSKVL-HFLANSK---RYSKVR----------------------------
-------------------------------SFLDSFVKNEKHTVSSVFHSLLLDGGRPG
--A-TALIIDMLVLAYVKN-LELHCAY---E---AFTRAK---D-YGFKLSLTSCNPLLS
ALVKENKIGDVEYV-YKEMIKRR-IH----TNLNTFNIFINGLCRAGKLN----------
---------KAEDAIEDMK-AWG--ISPNVVTYNTLVDGYCKRGSAGKMYK--AEAFMKE
M-LANKICPNEV--TFNTLIDGFCKDEN-VAAAKKAF-EEMQK-QG-LKPNIVTYNSLIN
GLCNNGKLEEAIDLWDKMVGLG-----L-KPNIVTYNALING-----------FCK-KKM
MKEATKVFDDVSK--QELVPNVITFNTMIDAYCKEGMMEEGFSLC-SSMLDEGILPNVST
YNCLIAGLCRKQDL-------------------------------------------QAA
KELLNEMENKGLK-----------------------------------------------
------------------------------------------------------------
-----------------------------------------------------GDVVTY-
------NILIDGLCKNDKSRN---AEKLLNEMFNLGLKPNHVTYNTLMDGYCMEGKLKAA
LNVRTRME---KERKQPNVVTYNVLIKGYCKINKL--EAANGL------------LNEML
E-KG-LNPNRTTYDIVRLEMLEKGF------------------SPDIEGHLYNI------
SSM---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------S
>gi|110738150|dbj|BAF01006.1|	   642 residues, 50 /line  642 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
-----GSS---------QSHCLYKNGDF-------LSDDSKCSPLSSS-RTSVRWVFNSS
SLPPPEWIEP----------------FNDVSDLVKSNRNLLPSPWVSQILNLLDGS--AS
ME-SNLDGF---------CRKF-LIKLSPNFVSFVLKSDEIREKPDIAWSFFCWSR-KQK
KYTH--NLECYVSLV-DVLALAKD---VDRIRFVSSEIKKF-------------------
--------------------------------------------------------E-FP
--M-TVSAANALIKSFGKL-GMVEELL---W---VWRKMK---E-NGIEPTLYTYNFLMN
GLVSAMFVDSAERV-FEVMESG-RIK----PDIVTYNTMIKGYCKAGQTQ----------
---------KAMEKLRDME-TRG--HEADKITYMTMIQACYADS---DFGS--CVALYQE
M-DEKGIQVPPH--AFSL---------------------------------------VIG
GLCKEGKLNEGYTVFENMIRKG-----S-KPNVAIYTVLIDG-----------YAK-SGS
VEDAIRLLHRMID--EGFKPDVVTYSVVVNGLCKNGRVEEALDYF-HTCRFDGLAINSMF
YSSLIDGLGKAGRV-------------------------------------------DEA
ERLFEEMSEKGCT-----------------------------------------------
------------------------------------------------------------
--------------RDSYCYNALIDAFTKHRKVDEAIALFKRMEEEE--G-CDQTVYTY-
------TILLSGMFKEHRNEE---ALKLWDMMIDKGITPT--------------------
------------------AACFRALSTGLCLSGKV--ARACKI------------LDELA
P-MG-VILDAACED-MINTLCKAGR-IKEAC-----------------KLADGITERGR-
EVPGRIRTVMINALRKVGKAD---------------------------------------
-----------------LAMKLMHSKIGI--------------------GYERMGSVKR-
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------RVKFTT-
---LLET------CFD-S
>gi|115445137|ref|NP_001046348.1|	   637 residues, 50 /line  637 residues, 50 /line  Os02g0226900 [Oryza sativa (japonica cultivar-group)]
-----MPR------------RLATTYSG-------RIAAARPSPAGPS-LT-----VTVA
PTPPPTPLD----------------------PRGYPLPRRHL---VCAAARILRSHASPS
PL-LDLADY---------LRGL-RLTLTAAEASEVVKA--LYGDPPLALAFFRFAAASLP
GFRH--DAFSYNRIL-ALLFRTRA--GPSEALRLVADMERDGV-----------------
-----------------------AGNISTINLLVGMGGGGVE---MERCLELASKWG-LR
--L-SGYTYKCIVQAHLRS-REVSKGF---Q---VYEEMR---R-KGYKLDIFAYNMLLD
ALAKAGMVDQAFQV-FEDMKQK-HCV----PDAYTYTILIRMSGKAGRTS----------
---------KFLSFFDEMV-SKG--CVLNLIAFNTIIEALGKNK---MVDK--VIFVLSK
M-VENDCQPNQF--TYSITLDILATEGQ-LHRLNEVL-D-ICS-RF-M--NRSIYSYLVK
SLCKSGHASEAHNVFCRMWNSH-----E-KGDRDAFVSMLEV-----------LCN-AEK
TLEAIDLLHMMPE--KGIVTDVGMYNMVFSALGKLKQVSFISNLF-DKMKTNGIIPDVFT
YNIMISSYGRVGLV-------------------------------------------DKA
SELFEVMEASSCK-----------------------------------------------
------------------------------------------------------------
--------------PDVVTYNSLINCLGKHGDLDEAHMLFKEMQEK---G-YDPDVFTY-
------SILIECFGKSNKVEM---ACSLFDEMISEGCTPN--------------------
------------------IVTYNILLDCLERRGKT--EEAHKL------------YETMK
Q-QG-LIPDSIT------------------------------------------------
------YSILERLESRSQRTV---------------------------------------
-----------------RIRKPTR------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------IS-
---GWVV------SPL-R
>gi|115458970|ref|NP_001053085.1|	   528 residues, 50 /line  528 residues, 50 /line  Os04g0477200 [Oryza sativa (japonica cultivar-group)]
----------------------TSAAAA-------VAAAARASPTSAAALALFKSVLSAD
KALSPLAVLP----------------H----LDGAPSSLPNL---LLTASAAVR------
------------------------------------------------------------
--------------------------PHATSLRLYSRMKSLSL-----------------
-----------------------PISTASLHPLLSALPSAP----AFALFADMFRLR-LP
--L-CTTTFNIMLRHLCSA-GKPARAL---E---LLRQMP--------RPNAVTYNTVIA
GFCSRGRVQAALDI-MREMRERGGIA----PNQYTYGTVISGWCKVGRVD----------
---------EAVKVFDEML-TKGE-VKPEAVMYNALIGGYCDQG---KLDT--ALLYRDR
M-VERGVAMTVA--TYNL---------------------------------------LVH
ALFMDGRGTEAYELVEEMGGKG-----L-APDVFTYNILING-----------HCK-EGN
VKKALEIFENMSR--RGVRATVVTYTALIYALSKKGQVQETDKLF-DEAVRRGIRPDLVL
YNALINSHSTSGNI-------------------------------------------DRA
FEIMGEMEKKRIA-----------------------------------------------
------------------------------------------------------------
--------------PDDVTYNTLMRGLCLLGRVDEARKLIDEMTER---G-IQPDLVTY-
------NTLISGYSMKGDVKD---ALRIRNEMMNKGFNPT--------------------
------------------LLTYNALIQGLCKNGQG--DDAENM------------VKEMV
E-NG-ITPDDSTYISLIEGLTTEDE-RAIDD-----------------ERL---------
------------------------------------------------------------
----------------------------A--------------------AADAAK-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------V
>gi|115474201|ref|NP_001060699.1|	   665 residues, 50 /line  665 residues, 50 /line  Os07g0688100 [Oryza sativa (japonica cultivar-group)]
-------------------MFLATRPSGSSSLITRLCVLHTVSWIVS-SRQVARFSTGVD
NANPGAHCR--------------------LSELFRPVRTETSCVI-------IGRALECG
RWSESVELE---------LEGL-HVELDPFVVNKVLRGL---LDSGMAVRFYWWAE-SRP
GFYH--NNFAIAYII-SLLFVDDN---FALLSEFLGRVRSQGV-----------------
-----------------------AFHRSLYRVLLAGYARAGKFDSVIETFDEMVTSG-CR
--E-FGVDYNRFIGVMIKN-CCFDLVE---K---YYNMAL---A-KGFCLTPFTYSRWIT
ALCQSNRIELVEEL-LTDMDKF-GCF----PDFWACNIYVHYLCGHNRLY----------
---------DALQMVEKMT-MKG--TGPDVVTYTTVVSCLCDHR---RFSE--AVGLWEE
M-VRRGLKPDVV--ACGALIFGLCKNQK-VDEAFELA-SRMLT-LD-IQLNVSIYNALIS
GFWRAGSIEKAYKTVSFMQRNG-----C-EPDVVTYNILLNH-----------YCS-IGM
TDKAENLIRKMEM--SGVNPDRYSYNILLKGLCKAHQLDKAFAFV-SDHMEVGGFCDIVS
CNILIDAFCRAKKV-------------------------------------------NSA
LNLFKEMGYKGIQ-----------------------------------------------
------------------------------------------------------------
--------------ADAVTYGILINGLFGIGYSNLAEELFDQMLNT---K-IVPNVNVY-
------NIMLHNLCKVGHFKH---AQKIFWQMTQKEVSPD--------------------
------------------TVTFNTLIYWLGKSSRA--VEALDL------------FKEMR
T-KG-VEPDNLTFRYIISGLLDEGK-ATLAY-----------------EIWEYMMENGI-
ILDRDVSERLISVLKLKN------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------N
>gi|115474409|ref|NP_001060801.1|	   624 residues, 50 /line  624 residues, 50 /line  Os08g0107800 [Oryza sativa (japonica cultivar-group)]
---MGVRG---------GGSALGRAGASSSKRTKQ-------GGRGGA-KRTKQGGRQRA
TEPG--------------------------------------------------------
------------------------------------------------DAHQVFDRLLKR
GDRA--SIFDLNRAL-SDVARASP----AVAISLFNRMPRAGA-----------------
-------------T-------SAAPNIATYGIVIGCCRRLGRLDLAFATVGRVITTG-LR
--M-SPILFSPLLKGLCDR-RRTSDAM---DI--VLRRMP---E-LGCKPDLFSYTILLK
GLCDDKTSQQALDL-LHIMADHKGRC---PLDVVAYTTVINGLLREGQLD----------
---------KAYSLFDAML-DRG--PSPDVVTYSSIISALSKTQ---AMDK--ATQVFTR
M-VKNGVMPDCI--MYTSLVHGYCSSGK-PKEAIGIF-KKMCR-HG-VEPDVVTYTALMD
YLCKNGKSTEARKIFDSLVKRG-----H-KPDSTTYGTLLHG-----------YAT-EGA
LVEMHDLLDLMMK--KGMQLGHHIFNMIMGAYAKHNKVDEALLVF-SNMRQQGLNPDIVN
YGTVLDILCTAGRV-------------------------------------------DDA
LSQFNSLKSEGLA-----------------------------------------------
------------------------------------------------------------
--------------PNIVVFTTLIHGLCTCDKWDKVEELAFEMIDR---G-ICLDTIFF-
------NAIMGNLCKKGRVIE---AKNLFDLMVRIGIEPN--------------------
------------------TNTYNTLIDGYCLDGKM--DEAMKL------------LGVMV
F-NG-VKPSDVTYNTIINGYSQNGR-IEDGL-----------------TLLREMDGKGV-
NPGIVTYEMLLQGLFQAGRTV---------------------------------------
-----------------AAKELYLRMIKW-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------DT-V
>gi|115476328|ref|NP_001061760.1|	   554 residues, 50 /line  554 residues, 50 /line  Os08g0402600 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------ALLSLGRHADVRRAFGILASA
GA----------------------------------------------------------
-----------------------RPDTFAWNKAVQACVAAGDLGEAVGMLRRMGRDG-AP
--PPNAFSYNVVIAGMWRA-GRGGDAV---E---VFDEMT---E-RAVLPNHITYNTMID
GHIKGGDLEAGFRL-RDQMVCH-GLK----PNAITYNVLLSGLCRAGRMG----------
---------ETSALLDEMA-SQK--MVPDGFTYSILFDGLSRNG---DSKA--MLSLFGK
Y-LKNGVTIGDY--TCSILLNGLCKDGK-VSIAEEVL-QSLVN-AG-LVPTRVIYNTLIN
GYCQTGELEGAFSTFGQMKSRH-----I-KPDHITYNALING-----------LCK-AER
ITNAQDLLMEMQD--NGVNPTVETFNTLIDAYGRTGQLEKCFIVL-SEMQENGLKPNVVS
YGSIVNAFCKNGKI-------------------------------------------PEA
VAILDDMFHKDVL-----------------------------------------------
------------------------------------------------------------
--------------PNAQVYNAIIDAYVEHGPNDQAFILVEKMKSN---G-ISPSIVTY-
------NLLIKGLCNQSQISE---AEEIINSLSNHRLIPD--------------------
------------------AVSYNTLISACCYRGNI--DKALDL------------QQRMH
K-YG-IKSTVRTYHQLISGLGGAGR-LNEME-----------------YLYQKMMQNNV-
VPSNAIHNIMVEAYSKYGNEI---------------------------------------
-----------------KAEDLRKEMLQK--------------------RNN--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------HDD-T
>gi|115481668|ref|NP_001064427.1|	   548 residues, 50 /line  548 residues, 50 /line  Os10g0358700 [Oryza sativa (japonica cultivar-group)]
--------------------MLRRSRHF-------LPPRPRRRPRPRRE--------APA
AEPPT------------------------------PTYTRDV---VRRVDAI----LRGH
PWS-AARPL---------LLSLPGLAWDSHTVARVLKAH---PPLHKAFLFFRLAAGAGG
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------G--FRHDRFTYTSMLHLLGEAG---RVPA--MMRLLAE
M-LRAGVDPDAA--TFTTVMHWLAHAGD-VDAAMRVW-EEMRARKGKCRPTLVSYTACVK
ILFDAGRPAEAREVFQEMVAEG-----L-RPSCKTYTVLIEH-----------LAN-VGK
FEATMEIMDKMQE--AGVEPDKALCNILVQKCSRAGETSVMTRIL-QYMKENFIVLRRPI
FLEALEALKANGESDNLLREVNPHLAFEGIECDPAFTDLGYITVRSTILYLLASRNWSAV
EHMINEMTPKNIK-----------------------------------------------
------------------------------------------------------------
--------------VESHILSDIIQASCANCRPSCGLAVLRYSLRI---G-NELDRSAY-
------GSLLGHYIRNGSFDL---VFEIVEILIKSGCNLG--------------------
------------------TYLSSILIIKLACAGHS--STAVRI------------FGLLT
T-D----KNVVTYTALMSAYFQDGK-VDKAL-----------------QLFLQMSANGV-
SACPGTYEVLIHGLQMAGRKQ---------------------------------------
-----------------ESEHYRRERMEM--------------------QW----HLQY-
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------RNEHSP-
---EDSLCNHLFCDFH-G
>gi|11994279|dbj|BAB01462.1|	   648 residues, 50 /line  648 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
--MNQNRN---------F----HFLLLL-------FSLTQHKGPTIHSLKKMIQRL----
-IPLNRKASN----------------FTQILEKGTS------------------------
-------------------------------------------------------LLHYS
SITE--AKLSYKERL-RNGIVDIK---VNDAIDLFESMIQSRP-----------------
-----------------------LPTPIDFNRLCSAVARTKQYDLVLGFCKGMELNG-IE
--H-DMYTMTIMINCYCRK-KKLLFAF---S---VLGRAW---K-LGYEPDTITFSTLVN
GFCLEGRVSEAVAL-VDRMVEM-KQR----PDLVTVSTLINGLCLKGRVS----------
---------EALVLIDRMV-EYG--FQPDEVTYGPVLNRLCKSG---NSAL--ALDLFRK
M-EERNIKASVV--QYSIVIDSLCKDGS-FDDALSLF-NEMEM-KG-IKADVVTYSSLIG
GLCNDGKWDDGAKMLREMIGRN-----I-IPDVVTFSALIDV-----------FVK-EGK
LLEAKELYNEMIT--RGIAPDTITYNSLIDGFCKENCLHEANQMF-DLMVSKGCEPDIVT
YSILINSYCKAKRV-------------------------------------------DDG
MRLFREISSKGLI-----------------------------------------------
------------------------------------------------------------
--------------PNTITYNTLVLGFCQSGKLNAAKELFQEMVSR---G-VPPSVVTY-
------GILLDGLCDNGELNK---ALEIFEKMQKSRMTLG--------------------
------------------IGIYNIIIHGMCNASKV--DDAWSL------------FCSLS
D-KG-VKPDVVTYNVMIGGLCKKGS-LSEAD-----------------MLFRKMKEDGC-
TPDDFTYNILIRAHLGGSGLI---------------------------------------
-----------------SSVELIEEMKVC--------------------GFSADSSTIK-
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------MVIDML-
---SDRRLDKSFLDML-S
>gi|124360736|gb|ABN08713.1|	   479 residues, 50 /line  479 residues, 50 /line  Pentatricopeptide repeat [Medicago truncatula]
----------------------------------------------MASKTLFKW-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---PKQIT-NSLVEQLIKAEKDINKTL---VMFDSATEEY---S-NGFRHDHNTFGAMIH
RLVSVNQFRPAEGM-LERMKQE-DCE----VTEDVFLTICRGYGRVHRPL----------
---------DAIRVFHKME-DFQ--VKPTQKSYLTVFDILVEEN---HVKR--AIGFYKE
M-REKGIPPTVV--SLNILIKALCKNEETVESAFRLF-REMPN-RG-CQPDSYTYGTLIN
GLCKLGKISQAKELLDEMEEKG-----L-SPSVVSYTSLIHG-----------LCQ-SNN
LDEAIELLEEMII--NGIEPNVFTYSSLMDGLCKSGHSSQAMELL-EVMVRRRLLPNMVT
YSTLINGLCKEGKH-------------------------------------------REA
VEILDRMRLQGLK-----------------------------------------------
------------------------------------------------------------
--------------PDAGMYGRIISGLCAACNYQEAANFIDEMALG---G-ISPNRASWT
FHVKMHNMVVQGLCNNVDPTR---AFQLYLSMRTRGISVE--------------------
------------------IGTFDCLVKCFCKRGDL--NKAARI------------LEEMI
L-DG-CIPDEGMWNVLMCGLWDRKK-VRETT-----------------ELLVAELKQKF-
V-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------EAE-S
>gi|125539937|gb|EAY86332.1|	   584 residues, 50 /line  584 residues, 50 /line  hypothetical protein OsI_007565 [Oryza sativa (indica cultivar-group)]
---MAAP-----------------------------APAPTASPPPPPAMSGLLSFASSR
PYPPLP---------------------APRPAAAAPRPRLRI------------------
--------------------------------------------------------AGSA
AAAP--NAVSHR------------------------------------------------
-----------------------ASSSFSSGDRLRSLVRRGELDEALRLVGS----A-RR
--P-DAGTCAALIKKLSAS-GRTAEAR---R---VLA---------ACGPDVMAYNAMMA
GYCGAGQVDAARRW-CA---ER-AVE----RDAYTCDTLIRGLCGRGRTA----------
---------NALAVLDEML-RRR--CVPDVVTYTILLEATCKRS---GYKQ--AMKLLDE
M-RDKGCTPDIV--TYNVVVNGICQEGR-VDDAIEFL-KNLPS-YG-CEPNTVSYNIVLK
GLCTAERWEDAEELMGEMGQKG-----C-PPNVVTFNMLISF-----------LCR-KGL
VEPALEVLEQIPK--YGCSPNSLSYNPLLHAFCKQKKMDKAMAFL-DLMVSRGCYPDIVS
YNTLLTALCRSGEV-------------------------------------------DVA
VELLHQLKDKGCA-----------------------------------------------
------------------------------------------------------------
--------------PVLISYNTVIDGLTKAGKTKEALELLNEMVSK---G-LQPDIITY-
------STIAAGLCREDRIED---AIRAFGKVQDMGIRPN--------------------
------------------TVLYNAIILGLCKRRET--HSAIDL------------FAYMI
G-NG-CMPNESTYTILIEGLAYEGL-IKEAR-----------------DLLDELCSRGE-
EILLDVHLIDVAFLTTF-------------------------------------------
--------------------------LPC--------------------SNANGGPFLR-
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------LPPEG--
---------SPVYDAL-L
>gi|125540677|gb|EAY87072.1|	   615 residues, 50 /line  615 residues, 50 /line  hypothetical protein OsI_008305 [Oryza sativa (indica cultivar-group)]
MPPLPRPP---------PTP---------TSAAPAPCPRQ---------IAAVVLNHPSS
ALTPAST-----------------------------------------------------
---RSLSAS---------LLAV-APSLPTPVADSVLKL--LWHHAPRALLFFH-SLLHLP
PRAHAVGPSTLDLAL-DLSARLRR--PRQLTNSILGLFPRHRL-----------------
-----------------------------------------------------------A
--F-TPRTFPILFERLAVS-----------------------------------------
----QRRPDLAVRL-FLSLHRSHRVA----QDLPLFNSLLDALSKSRHAG----------
---------KAASLVRALE-QR---FTPDVVTYNTLADGWCRVK---DTSR--ALDVLRL
M-VESGIAPTKT--TYNI---------------------------------------ILK
GFFRAGQLRHAWDFFLQMKKRGSKDESC-KPDVVSYTTMVHG-----------LGV-AGQ
LEKARKVFDEMAK--EGCAPSVATYNALIQVICKKGNVEDAVTVF-DGMLVKGYVPNVVT
YTVLIRGLCHAGKI-------------------------------------------DRG
LKLLERMKNGGCE-----------------------------------------------
------------------------------------------------------------
--------------PIVQTYNVLIRYLFEEGEMEKGLDLFEKMSKGE--E-CLPNQDTY-
------NIIISAMFMRKRAEDMVLAARMVDEMVDRGYLPR--------------------
------------------RFMFNQHHISFKSTHRWSYDESNCK------------YHLII
V-FERAPTEIFSLSLLVQ------------------------------------LQFGM-
IGSKAVYQMIYGDWKVLATVSRKSQ------------STATAPCLAISLKVGVFGVRVLQ
GHRAPVVIDLAKSILIFPGADHVDALLKK--------------------TDRASEHLYI-
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------CTGRGTI
KEIQQSAKFATANDQT-G
>gi|125544564|gb|EAY90703.1|	   644 residues, 50 /line  644 residues, 50 /line  hypothetical protein OsI_011936 [Oryza sativa (indica cultivar-group)]
--------------------------MLTSSLPPPTVPGSKPRPAAAT-SVSTAATANAA
VAGGRSGSGS----------------GS--------------------------------
------------------------------------------------------------
------GIGRLSALI-RSLCSAGR--TAEAARALADAGDAAGV----VAYNAMVAGYCRA
GQLAAARRL-AAAV-------PVPPNAYTFFPVVRGLCTRGRIADALEVLDEMSFKG-CA
--P-IPPMYHVILEAACRS-GGFRNSV---R---VLEAMH---A-KGCTLDTGNCNLVLN
AICEQGCVDEAVGL-LRKLAFF-GCE----ADIVSYNAVLKGLCMAKRWG----------
---------DVEELMDEMV-RVD--CAPNIVTFNTLIGYLCRNG---LFER--VHEVLAQ
M-SEHGCTPDIR--MYATIIDGICKEGH-LEVANEIL-NRMPS-YG-LKPNVVCYNTVLK
GLCSAERWKEAEELLSEMFQKD-----C-PLDDVTFNILVDF-----------FCQ-NGL
VDRVIELLEQMLS--HGCMPDVITYTTVINGFCKEGLIDEAVMLL-KSMSSCGCKPNTVS
YTIVLKGLCSAGRW-------------------------------------------VDA
EELMSQMIQQGCP-----------------------------------------------
------------------------------------------------------------
--------------PNPVTFNTLINFLCKKGLVEQAIELLKQMLVN---G-CSPDLISY-
------STVIDGLGKAGKTEE---ALELLNVMVNKGISPN--------------------
------------------TIIYSSIACALSREGRV--NKVIQM------------FDNIK
D-TT-IRSDAVLYNAVISSLCKRWE-TDRAI-----------------DFFAYMVSNGC-
MPNESTYTMLIKGLASEGLAK---------------------------------------
-----------------EAQELLSELCSR--------------------GALRKHL----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------MRHFGI-V
>gi|125548610|gb|EAY94432.1|	   485 residues, 50 /line  485 residues, 50 /line  hypothetical protein OsI_015665 [Oryza sativa (indica cultivar-group)]
-------M---------ACHLLRHRLP---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------HLAHPLLRLLASRLGRSSPPRVLPLLLSAAAAA-PG
--D-PASLLSALSSAYAEE-GLLPDAC---T---LVLLAL---R-RGIRLEPTSCTGLMS
RF---PTAPEACAF-YLQLLDA-GLP----PEAKLFNVLMRDLVRLGELA----------
---------SAQNVFDEMQ-SRG--VRRTVVSFNTMISGMCRAG---DLDG--AETLHRR
M-SEAGVTPDVY--TYGALIQGLCRVGR-IEDARGVF-EKMCG-RG-MKPNAVVFTILID
AHCKKGDAETMLELHREMRERG-----V-RPDAVTYNAIVNG-----------LCR-ARD
LKSASGIVVEMRS--AGLRPDTVTYTTLIDGYCKEEELDMAMEIK-QNMVAEGVGLDEVT
YTALISGLSKAGRS-------------------------------------------ADA
ERVLGEMMEAGLE-----------------------------------------------
------------------------------------------------------------
--------------PDNTTYTMVIDAFCRKGDVKTGLRLLKEMQNK---G-RKPGVVTY-
------NVIMNGFCKLGQMKN---ADMLLNAMINIGVSPD--------------------
------------------DITYNILLDGHCKHGKV--TDIEEL---------------KS
A-KG-TVPDLGVYTSIVGEIVKKKT-TKTYH-----------------D-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------R
>gi|125554437|gb|EAZ00043.1|	   579 residues, 50 /line  579 residues, 50 /line  hypothetical protein OsI_021275 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------MGVYARSGRFD----------
---------DARQLLDAMR-DQD--IEPDLVSFNTLINARAKSG---CLAAGVALELLHE
V-RQAGLRPDAI--TYNTLISACSQGSN-LDDAVAVF-EEMIA-SE-CRPDLWTYNAMVS
VHGRCGKAQEAELMFKELVEKG-----F-QPDAVTYNSLLYA-----------FAK-EGD
VERVERVCEELVK--AGFRKDGITYNTMIHMYGKMGRLDLALGLY-DEMRAIGCTPDAVT
YTVLVDSLGKMDRI-------------------------------------------SEA
GKVLEEMADAGLK-----------------------------------------------
------------------------------------------------------------
--------------PTLVTFSALICAYAKSGRQDDAERTFDRMVES---G-VKPDRLAY-
------LVMLDVFARSDETRK---LMVLYRAMIKDGYKPD--------------------
------------------DGLYQVLLAALAKGNEH-------------------------
---------------------------DEIE-----------------GVIQDMEAVFE-
MNPLVISSILIKAECIS-------------------------------------------
-----------------QGASLLKRACLQ--------------------GYEPDVEEKDW
GADLRKLSAGAALVALTLWLDQMQGAPESPKSIVLVTGEGEYNMVSLRKTIRAYLLEMGS
PFLPCRSRSGRFVVKAYSLKMWLKDSPFCLDLELKDAPALPKTNSMKLTEGYFMRAGLVP
VFKDIHERLGEVWPKKFSRLALLSEESRDEVIKADIKGRKEKLEKMKKQGLAIAKRSKRG
PRRGKFVKQQSTQEVL-K
>gi|125555457|gb|EAZ01063.1|	   552 residues, 50 /line  552 residues, 50 /line  hypothetical protein OsI_022295 [Oryza sativa (indica cultivar-group)]
MAAVGWHV---------R-----------------MKGRRKGGGGGGPLLALR--LFLAP
LHPAAVTHHS----------------FNSALLRFP-------------------------
-----------------------------------------LPPHLLPPFFSRSLRRFPG
RLAP--TL---------------------------------------LSFNLLLKCVCSS
LVPRDP------------------------------------------------------
-------------------RRYLDVAL---R---ILHEII--PG-WDLAPDKFTYSTVVS
ALADAGRVDDAVAL-VHEMVAD-GVV----A-AEAFNPVLRAMLRAGDVK----------
---------GAAKLFEFMQ-LKG--CVPTAATYNVLVHGLLVCG---RAGA--AMGVMRR
M-EREGVVPGVM--TYGAVVDGLVRCGR-VKDAWKVA-EEMER-NG-LARNEFVYSTVIT
GFCKSGEIDCALKVWEAMVASP-----V-RPNVVLYSAMIGG-----------LAN-FGK
MTEAELLFREMID--SKCAPNIITYGSMIQGYFKIGDTSRALSVW-EEMIGAGCMPNAVS
YSILINGLCNVGRL-------------------------------------------KDA
MMVWKHMLDRGCA-----------------------------------------------
------------------------------------------------------------
--------------PDTIAYTSMIKGLCVSGMVDGGLRLFYDMLAS---GHADPDVISY-
------NVLLDGLLLAKDLPR---AMDLLNRMLDQGCDPD--------------------
------------------TVTCNIFLREFGAGERK----GREF------------LEGLV
V-----------------RLCDRRR-NMAAG-----------------EVLMVMLAKYI-
VPEAPIWEMVVRDVCRRKRVWRVI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------DKCWDEIWGP
>gi|125555763|gb|EAZ01369.1|	   619 residues, 50 /line  619 residues, 50 /line  hypothetical protein OsI_022601 [Oryza sativa (indica cultivar-group)]
-MLLPLPP---------RRRLL-------------LLIYPRRRPAAAAFSTLP-------
---------------------------TPPAAAAPISHRLRL------------------
-----------------------LRSLQSVPADRLLSHP---LPSTAHACLAAHLL----
--ARDRLYAHSRRVL-SRLVALRR---PHLAASLVDLLHRAAL-----------------
------------AL-------GPRRS----------------------------------
---ALASVVDTLLSVLADR-GLLDDAV---R---AVARVR---E-LRVPPNTRTCNHILL
RLARDRSG----RL-VRRLFEQ-LPA----PNVFTFNIVIDFLCKEGELA----------
---------EARSLFSRMK-EMG--CLPDVVTFNSLIDGYGKCG---ELDE--VEQLVEE
M-RRSGCKADVV--TYNALINCFCKFGR-METAYGYF-AAMKR-EG-VMANVVTFSTFVD
AFCKEGLVREAMKLFAQMRVRG-----M-ALNEFTYTCLIDG-----------TCK-AGR
LDDAIVLLDEMVR--QGVPLNVVTYTVLVDGLCKERKVAEAEDVL-RMMEKAGVRANELL
YTTLIHGHFMNKNS-------------------------------------------EKA
LGLLSEMKNKGLE-----------------------------------------------
------------------------------------------------------------
--------------LDISLYGALIQGLCNVHKLDEAKSLLTKMDES---G-LEPNYIIY-
------TTMMDACFKSGKVPE---AIAMLQKILDSGFQPNN-------------GCLNEA
VQLFNEMV---HKGMSLDKVVYTALLDGYLKQGNL--HDAFAL------------KAKMI
D-SG-LQLDLFCYTCFISGFCNLNM-MPEAR-----------------EVFSEMIGHGI-
APDRAVYNCLITQIPEIRELGGGN------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------KSSG
>gi|125558386|gb|EAZ03922.1|	   658 residues, 50 /line  658 residues, 50 /line  hypothetical protein OsI_025154 [Oryza sativa (indica cultivar-group)]
MRRFCHVP---------LCRRVAAASHGGHPHQPPLPPPEWIEPYTD---LSDPSPYAAS
SASSSP---T----------------PSPWL--------------ARVVSLVLRSPPATL
AADLRAFCA---------TFLLRLSPAFVAAALRSPHLLPNPLPSLHFYRSLPSAVAGDL
LSHPHHLVSCYVSLL-RSFAHSSS--S----------------------SSSREAAPDAA
AAAAHARQL-VAELRAHGDTALRHLTPSSSASLIRSLAALGLAEELLWAWKAMR------
-------------------------------------------L-AGVEPSRLIYNCLLD
GLVNAGLLDTAVNV-FDAMSTEDQVR----PDVVSYNILIKGYCRAGRAH----------
---------DAMARLSEMQ-EQAK-LTPDKVTYLTLMQCHYSEG---TFPV--CIGLFQE
M-EERGMGNDIPQHAYVLVIGALCKDGK-PFEGMAVF-ERMLK-RG-CAANAAIYTALID
SMGKFGREKEAMALFERMKDSG-----L-KLDSVTYGVIVNC-----------LCR-FGK
LDEAVACFRSCQE--KGIAVNAIFYTSLIDGFGKAGMVDQSKELF-EEMIAKGFVPDSYC
YNVLIDGLAKSGRM-------------------------------------------DDA
CALYKRMEDDGCD-----------------------------------------------
------------------------------------------------------------
--------------QTVYTYTILIDGLFKEHKNEEALKFWDAMIDK----GITPTAAAF-
------RTLASGLCLSGKFSR---ACRILDELAPMGVIPE--------------------
-------------------TAHEDMINVLCKAGRF--KQACKL------------ADGIV
Q-KG-REIPGRVRTMMINALRKAGN-TDLAV-----------------KLVHSKIGIG--
------------------------------------------------------------
--------------------------------------------------YERSGSIKR-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------RVKFQTLFQ
>gi|125559206|gb|EAZ04742.1|	   624 residues, 50 /line  624 residues, 50 /line  hypothetical protein OsI_025974 [Oryza sativa (indica cultivar-group)]
---MARRA---------RLR-LRLVRALATA----SASGSPAAPRPARQAAPYLAVLHRR
G--------------------------------------------RAEAAACLNRHLR--
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------LLPLGEATSLLDALPSV----
---RDAVSYNTVLTALCRR-GHHDRAG---A---LLRAMSLEPH-PACRPNAVSYTVLMR
ALCADRRADQAVGL-LRSMRSA-GVR----ADVVTYGTLIRGLCDAAEVD----------
---------KAVELMGEMC-ESG--IEPNVVVYSSLLQGYCKSG---RWED--VGKVFVE
M-SEKGIEPDVV--MYTGLIDSLCKVGK-AKKAHGVM-DMMVR-RG-LEPNVVTYNVLIN
CMCKEGSVKEAIGVLKKMSEKG-----V-APDVVTYNTLIKG-----------LSD-VLE
MDEAMWLLEEMVRGENIVKPNVVTFNSVIQGLCDIGRMRQAFQVR-AMMEETGCMVNLVT
YNLLIGGLLRVHKV-------------------------------------------RKA
MELMDEMTCLGLE-----------------------------------------------
------------------------------------------------------------
--------------PDSFTYSILIKGSCKMWQVDRAEDLLSTMRDR---G-IEPELFHY-
------IPLLVAMCEQGMMER---ARNLFNEMD-NNFPLD--------------------
------------------VVAYSTMIHGACKAGDL--KTAKEL------------LKSMV
D-EG-LTPDAVTYSIVINMFAKSGD-MEAAN-----------------GVLKQMTASGF-
LPDVAVFDSLIQGYSTKGEIN---------------------------------------
-----------------KVLELIREMITK--------------------NIALDSKIIS-
------------------------------------------------------------
------------------------------------------------------------
---------------------TLSTSLVASNE------GKALLQSLPDFSAEISKGNINS
PQELMKVLHNVCP--QTN
>gi|125561029|gb|EAZ06477.1|	   621 residues, 50 /line  621 residues, 50 /line  hypothetical protein OsI_027709 [Oryza sativa (indica cultivar-group)]
-------------------------------MPPPTP------------LARLLAAISAA
ASSPADL-----------------------------------------------------
---RRLSHR---------VLSP--------------------------------------
------------------------------------------------------------
--------------------SAPLPPLRCLNTLLMALARHRMFPDMESLASRMPAR----
----NLRTYTTLINAYCLA-GDIPAAK---Q---HLTSLL---H-AGLAPDSYAYTSFVL
GYCRAGMLTHACRV-FVLMPLR-GCL----RTAFTYTALLHGLLGAGMVR----------
---------EAMTVFVGMR-ADS--CAPDTHVYATMVHGLCEAG---RTEE--AEVLLEE
A-MSNGFEPNIV--VYNALIDGYCNAGE-MEHALKVF-EGMDG-NR-CSPNVRTYTELIH
GLCKSGKVERAMVLFSRMVEAG-----L-EPNVVTYTALIQG-----------QCN-EGH
LQCAFRLLHLMET--NGLVPNDWTFSVLIDALCKREKVEEAQLFL-GSLVKKGVKVNEVV
YTSLIDGLCKTGKI-------------------------------------------DAA
DELMQKMISEGFV-----------------------------------------------
------------------------------------------------------------
--------------PDAHSYSSLIDGLCRQKKLSQATLMLEDMMEK---G-IQASPVTY-
------TIIIDELVREVGSEG---PKKIFDKMIATGINPD--------------------
------------------IVTYTVFVRSYCEEGRM--EDAESM------------IVQMV
D-RG-VFPNLVTYNTLIRGYANLGL-VSQAF-----------------STFEVMVGKGW-
KPNEDSYTVLLRLVVKKSSSDNSVDIWKIADMKDLQVLLEDITERQLPLAADIYSC----
-----FIRCLCRVDRLEEAKHFFMGMQNA--------------------NLTPSEDVYT-
------------------------------------------------------------
------------------------------------------------------------
---------------------SIIDCCA--------------------------------
-----------------D
>gi|125575262|gb|EAZ16546.1|	   623 residues, 50 /line  623 residues, 50 /line  hypothetical protein OsJ_030755 [Oryza sativa (japonica cultivar-group)]
-----------------MARRVPTRPRGGGGGGVP-----------RSEGSIQGRGGRAG
GSG---------------------------------------------------------
------------------------------------------------------------
---------------------------AEDARHVFDELLRRGR-----------------
-----------------------GASIYGLNRALADVARHSPA-AAVSRYNRMARAG-AG
KVTPTVHTYAILIGCCCRA-GRLDLGF---A---ALGNVV---K-KGFRVDAITFTPLLK
GLCADKRTSDAMDIVLRRMTEL-GCI----PDVFSYNNLLKGLCDENRSQEALELLHMMA
DDRGGGDSDKAYSTYHEML-DRG--ILPDVVTYSSIIAALCKAQ---AMDK--AMEVLNT
M-VKNGVMPDCM--TYNSILHGYCSSGQ-PKEAIGTL-KKMRS-DG-VEPNVVTYSSLMN
YLCKNGRSTEARKIFDSMTKRG-----L-EPDIATYRTLLQG-----------HCK-EGR
VIESEKLFDLMVR--IGVKPDIITYNTLIDGCCLAGKMDEATKLL-ASMVSVGVKPDIVT
YGTLINGYCRVSRM-------------------------------------------DDA
LALFKEMVSSGVS-----------------------------------------------
------------------------------------------------------------
--------------PNIITYNIILQGLFHTRRTAAAKELYVSITKS---G-TQLELSTY-
------NIILHGLCKNNLTDE---ALRMFQNLCLTDLQLE--------------------
------------------TRTFNIMIGALLKCGRM--DEAKDL------------FAAHS
A-NG-LVPDVRTYSLMAENLIEQGS-LEELD-----------------DLFLSMEENGC-
SADSRMLNSIVRKLLQRGDIT---------------------------------------
-----------------RAGTYLFMIDEK--------------------HFSLEASTASF
LLE---------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------SS
PIVWEQI-------SRIS
>gi|125582652|gb|EAZ23583.1|	   667 residues, 50 /line  667 residues, 50 /line  hypothetical protein OsJ_007066 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MVRSG-WR
--P-DAYTFNSLIVGYCRT-NQVDVAR---D---LFDKMP---L-RGFAQDVVSYATLIE
GLCEAGRIDEAVEL-FGEMDQ---------PDMHMYAALVKGLCNAERGE----------
---------EGLLMLRRMK-ELG--WRPSTRAYAAVVDFRCRER---KAKE--AEEMLQE
M-FEKGLAPCVV--TCTAVINAYCKEGR-MSDALRVL-ELMKL-RG-CKPNVWTYNALVQ
GFCNEGKVHKAMTLLNKMRACG-----V-NPDAVTYNLLIRG-----------QCI-DGH
IESAFRLLRLMEG--DGLIADQYTYNALINALCKDGRTDQACSLF-DSLETRGIKPNAVT
FNSLINGLCKSGKA-------------------------------------------DIA
WKFLEKMVSAGCT-----------------------------------------------
------------------------------------------------------------
--------------PDTYTYSSFIEHLCKMKGSQEGLSFIGEMLQK---D-VKPSTVNY-
------TIVIHKLLKERNYGL---VARTWGEMVSSGCNPDVVTYTTSMRAYCIEGRLNEA
ENVLMEMS---KNGVTVDTMAYNTLMDGHASIGQT--DHAVSI------------LKQMT
S-VA-SVPNQFTYFILLRHLVRMRL-VEDVLPLTPAGVWKAIELTDVFGLFDVMKKNEF-
LPNSGTYSSILEGFSEDGRTEEATSLVS------------LMKEDSISLNEDIYTA----
-----LVTCFCKSKRYLDAWVLVCSMIQH--------------------GFIPQLMSYQH
LLS---------------------------------------------------------
--------------------------------------------------GLICEGQTDK
AKEIFMNSRWKDYSPDEIVWKVIIDGLIKKGH------SDISREMIIMLER-----MNCR
PSHQTYAMLTEELP-DRE
>gi|125587025|gb|EAZ27689.1|	   650 residues, 50 /line  650 residues, 50 /line  hypothetical protein OsJ_011172 [Oryza sativa (japonica cultivar-group)]
MKV---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------LVAEMRREGHQVKLGVVHSFLDSYEGQ
QLFDDAVDLILNQLQPLF---GIQADTVVYNHLLNVLVEGSKMKLLESVYSEMGARG-IK
--P-DVVTFNTLMKALCRA-HQVRTAV---L---MLEEMS---S-RGVAPDETTFTTLMQ
GFVEEGSIEAALRV-KARMLEM-GCS----ATKVTVNVLINGYCKLGRVE----------
---------DALGYIQQEI-ADG--FEPDQITYNTFVNGLCQND---HVGH--ALKVMDV
M-VQEGHDPDVF--TYNIVVNCLCKNGQ-LEEAKGIL-NQMVD-RG-CLPDITTFNTLIA
ALCTGNRLEEALDLARQVTVKG-----V-SPDVYTFNILINA-----------LCK-VGD
PHLALRLFEEMKN--SGCTPDEVTYNTLIDNLCSLGKLGKALDLL-KDMESTGCPRSTIT
YNTIIDGLCKKMRI-------------------------------------------EEA
EEVFDQMDLQGIS-----------------------------------------------
------------------------------------------------------------
--------------RNAITFNTLIDGLCKDKKIDDAFELINQMISE---G-LQPNNITY-
------NSILTHYCKQGDIKK---AADILETMTANGFEVDVVTYGTLINGLCKAGRTQVA
LKVLRGMR---IKGMRPTPKAYNPVLQSLFRRNNI--RDALSL------------FREMA
E-VG-EPPDALTYKIVFRGLCRGGGPIKEAF-----------------DFMLEMVDKGF-
IPEFSSFRMLAEGLLNLGMDDYFIRAIEII-------------MEKVDLRESDVSA----
------IRGYLKIRKFYDALATFGRF----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LEINNPQWSYR
>gi|125596079|gb|EAZ35859.1|	   575 residues, 50 /line  575 residues, 50 /line  hypothetical protein OsJ_019342 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------MVR-HGVAPNVYTYNILVR
ALCARGRLEEAVGV-VGDMRGAG--C---APNAVTYNTLVAAFCRAGELD----------
---------GAERVVSLMR-EEGN-AKPNLVTFNSMVNGLCKAG---RMEG--ARKVFDE
M-VREGLAPDVV--SYNTLLSGYCKVGC-LHESLAVF-SEMTQR--GLVPDVVTFTSLIH
ATCKAGNLEQAVALVAQMRERG-----L-RMNEVTFTALIDG-----------FCK-KGF
LDDALLAVEEMRK--CGIQPSVVCYNALINGYCKLGRMDLARELI-REMEAKRVKPDVVT
YSTIISGYCKVGNL-------------------------------------------DSA
FQLNQKMLKKGVL-----------------------------------------------
------------------------------------------------------------
--------------PDAITYSSLIRGLCEEKRLNDACELFENMLQLG--V---------Q
PDEFTYTTLIDGHCKEGNVEK---ALSLHDEMIRKGVLPDVVTYSVLINGLSKSARTKEA
HRLLFKLY---HEDPVPDNIKYDALMLCCSKAEFKSVVALLKGFCMKGLMKEADKVYQSM
L-DRNWKLDGSVYSILIHGHCRGGN------------------VRKALSFHKQMLRSGF-
SPNSTSTISLVRGLFEEGMVVEADNAIQDL--LTCCPLADAEA-----------------
-------SKALIDLNRKEGMDYFQAQGEI--------------------WYSESSP----
--------------SVEYWNYMM-------------------------------------
------------------------------------------------------------
-----------------------------------------------------------T
ICHFGVWSTYFSMLRLTK
>gi|125599704|gb|EAZ39280.1|	   659 residues, 50 /line  659 residues, 50 /line  hypothetical protein OsJ_022763 [Oryza sativa (japonica cultivar-group)]
MAVLGYGL---------PNQACAHLAAALVRARRLDERRPRRRRHAAAQ-----------
---------------------------VPPGVLGVHGADRRA---GRGAEARARAETAEN
RAGG--------------------------------------------------------
---------------------RAG--NVDMAWKFFHELKAQG------------------
----------------------LKPDDVSYTSMIWVLCKAGRLGEAEELFAQMEAER-SV
---PCAYAYNTMIMGYGSA-GRFEDAY---K---LLERLR---E-RGCIPSVVSFNSILT
CLGKKRKVDEALSL-FEVMKK--DAE----PNSSTYNIIIDMLCLGGRVE----------
---------EAYRILDEME-HAS--LFPNLLTVNIMVDRLCKAR---KLEE--AYKIFES
A-SQRGCNPDCV--TYCSLIDGLGKKGQ-VDEAYRLF-EKMLD-AG-HNANPVVYTSLIR
NFFIHGRKEDGHKIFKELIRRG-----C-KPDLTLLNTYMDC-----------VFK-AGE
VEKGRMIFEDIRS--YGFLPDVRSYSILIHGLTKAGQARETSNIF-HAMKQQGFALDARA
YNAVVDGFCKSGKV-------------------------------------------HKA
YEILEEMKEKCVQ-----------------------------------------------
------------------------------------------------------------
--------------PTVATYGAIVDGLAKIDRLDEAYMLFEEAKSK---G-IELNVVLY-
------SSLIDGFGKVGRIDE---AYLILEEMMKKGLTPNVYTWNSLLDALVKAEEINEA
LVCFQSMK---EMKCPPNTYTYSILINGLCRVQKY--NKAFVF------------WQDMQ
K-QG-LVPNVVTYTTMISGLAKVGN-ITDAY-----------------SLFERFKANGG-
IPDAASFNALIEGMSNANRAM---------------------------------------
-----------------EAYQLSSSSCSW--------------------NFLV-------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------PDEG
>gi|140049648|gb|ABO79767.1|	   624 residues, 50 /line  624 residues, 50 /line  Pentatricopeptide repeat [Medicago truncatula]
MKFLKTFN---------SKSIYRHSKTLSNSSLYTTTTSAPPSP----------------
----PITETK----------------FLEYIQ----------------------------
---TSQWHF---------IKHL-APNLTPSLLSSTLPTL---HQNPILVETLLSH---LH
RHPHCLDLNTRCITL-CILYR---------------------------------------
-----------------------LPSPKPSFHILQPILHTTTPTVIFNELSLARNRL-NV
---KTTLVFDLLLSAYCQF-RKPDEAL---E---CLNLMK---E-NEIIPKTETCNSLLS
LLLKLNKIKMAWFV-YEEMVKM-NIK----SSIVTFNIMINILCREGKWK----------
---------KAKDFIGHME-VYG--VKPNVVTYNTVINGYCLRG---KFEA--ASKIFKT
M-KDKNLKPDCY--TYNSFISRLCKERR-IEEASGVL-CKLLE-SG-LVPNAVTYNALID
GCCNKGDLDKAFAYRDEMMNRG-----I-VASVFTYNLLIHA-----------LFL-EKR
IEEAEDMIKEMRE--KGVEPDVVTYNIQINGYCRCGNAKKALSLF-DEMVEKNIRPTVET
YTSLIDVFGKRNRM-------------------------------------------SEA
EEKFKKSIKEGML-----------------------------------------------
------------------------------------------------------------
--------------PDIIMFNALIDGHCVNGNIDRAFQLLKEMDNA---K-VVPDEVTF-
------NTLMQGYCRERKVEE---AKKLLDEMKERGIKPDHISYNTLISGYSKRGDMKDA
LEVFDEML---SLGFDPTLLTYNALIQGYSKIGEA--DHAEEL------------LREMQ
S-KG-ITPDDSTYLYVIEAMKTNDD-LVENDD----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------K
>gi|147833323|emb|CAN61988.1|	   553 residues, 50 /line  553 residues, 50 /line  hypothetical protein [Vitis vinifera]
MDLIVPVS---------QTH--------EGLYSLQHVHRENTTKTCLGTRARFR------
------------------------------------------------SNLVLGGGNYTS
N-----------------------------------------------------------
------------------------------------------------------------
--------------------SSSSIEEHES------------------------------
---------NNHLRRLVRN-GELEDGF---K---FLESMV---Y-RGDIPDIIPCTSLIR
GFCRIGKTKKATWV-MEILEQS-GAV----PDVITYNVLISGYCKSGEID----------
---------NALQVLDRM----N--VAPDVVTYNTILRTLCDSG---KLKQ--AMEVLDR
Q-LQKECYPDVI--TYTILIEATCKESG-VGQAMKLL-DEMRN-KG-SKPDVVTYNVLIN
GICKEGRLDEAIKFLNNMPSYG-----C-QPNVITHNIILRS-----------MCS-TGR
WMDAEKLLSDMLR--KGCSPSVVTFNILINFLCRQGLLGRAIDIL-EKMPMHGCTPNSLS
YNPLLHGFCKEKKM-------------------------------------------DRA
IEYLDIMVSRGCY-----------------------------------------------
------------------------------------------------------------
--------------PDIVTYNTLLTALCKDGKVDVAVEILNQLSSK---G-CSPVLITY-
------NTVIDGLSKVGKTER---AIKLLDEMRRKGLKPDIITYSSLVSGLSREGKVDEA
IKFFHDLE---GLGIRPNAITYNSIMLGLCKSRQT--DRAIDF------------LAYMI
S-KR-CKPTEATYTILIEGIAYEGL-AKEAL-----------------DLLNELCSRGL-
VKKSSAEQVAVK------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------M
>gi|147834641|emb|CAN60904.1|	   580 residues, 50 /line  580 residues, 50 /line  hypothetical protein [Vitis vinifera]
-------M---------AGXTISRARSLSNKSCCFHAP---------MGASLRPXFLGSA
ANTPNAGDTN----------------SSTFHFSFNRNFNSLASSEST---PPITZEVISK
SVLSSQWHF---------IEQV-SPNLTPALISNVLYN--LCSKPQLVSDFIHHLH----
--PHCLDTKSYCLAV-VLLARLPS---PKLALQLLKQVMET-------------------
------------------------------------------------------------
---------------------RIATNR---E---LFDELTL-------SRDRLSVKSSIV
FDLLEGKLKKAREF-IGFMEGL-GFK----PNVVSYNTIIHGYSSRGNIE----------
---------GARRILDAMR-VKG--IEPDSYTYGSLISGMCKEG---RLEE--ASGLFDK
M-VEIGLVPNAV--TYNTLIDGYCNKGD-LERAFSYR-DEMVK-KG-IMPSVSTYNLLVH
ALFMEGRMGEADDMIKEMRKKG-----I-IPDAITYNILING-----------YSR-CGN
AKRAFDLHNEMLS--KGIEPTHVTYTSLIYVLSRRNRMKEADDLF-EKILDQGVSPDVIM
FNAMIDGHCANGNV-------------------------------------------ERA
FMLLKEMDRKSVP-----------------------------------------------
------------------------------------------------------------
--------------PDEVTFNTLMQGRCREGKVEEARMLLDEMKXR---G-IKPDHISY-
------NTLISGYGRRGDIKD---AFXVRDEMLSIGFNPTLLTYNALIKCLCKNQEGDLA
EELLKEMV---NKG----------------------------------------------
-----ISPDDSTYLSLIEGMGNVDT-LVEDNA----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------S
>gi|147861320|emb|CAN83994.1|	   559 residues, 50 /line  559 residues, 50 /line  hypothetical protein [Vitis vinifera]
MATP----------------KILTTRNFL------------SSPRGGFLCFSTWM-----
TPPTSHCHDP--------------------------------------ILTTISEAIKVS
PT-KPLHSS---------LKRI-LPSLTPNHLIDLINLNPHSLSPPSLLSFFKWLS-TQH
HF--RLSIHSYCTMT-HFLCTHKM---LSEAQ----------------------------
------------------------------------------------------------
----------SLLQFVVSRKGKNS-AS---SV--FTSVLE---A-RGTHQSNLVFSVLMN
AYTDSGYFSDAIQC-FRLVRKH-NLQ----IPFHSCGYLFDRLMKLNLTS----------
---------PAWAFYEEIL-DCG--YPPDVCKFNVLMHRLCKEH---KINE--AQLLFGE
I-GKRGLRPTVV--SFNTLINGYCKSGN-LDQGFRLK-RFMME-NR-VFPDVFTYSVLIN
GLCKEGQLDDANKLFLEMCDRG-----L-VPNDVTFTTLING-----------HCV-TGR
ADLGMEIYQQMLR--KGVKPDVITYNTLINGLCKVGDLREAKKLV-IEMTQRGLKPDKFT
YTMLIDGCCKEGDL-------------------------------------------ESA
LEIRKEMVKEGIE-----------------------------------------------
------------------------------------------------------------
--------------LDNVAFTALISGFCREGQVIEAERTLREMLEA---G-IKPDDATY-
------TMVIHGFCKKGDVKT---GFKLLKEMQCDGHVPGVVTYNVLLNGLCKQGQMKNA
NMLLDAML---NLGVVPDDITYNILLERTLQAWKQ-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------GGF
>gi|15221549|ref|NP_176454.1|	   630 residues, 50 /line  630 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
MRISFA--------------IASTAKRFVHRSLVVRGNAATVSPSFS-------------
-----------------------------------FFWRRAFSGK---------------
------------------------------------------------------------
------TSYDYREKLSRNGLSELK---LDDAVALFGEMVKSRP-----------------
-----------------------FPSIIEFSKLLSAIAKMNKFDVVISLGEQMQNLG-IP
--H-NHYTYSILINCFCRR-SQLPLAL---A---VLGKMM---K-LGYEPNIVTLSSLLN
GYCHSKRISEAVAL-VDQMFVT-GYQ----PNTVTFNTLIHGLFLHNKAS----------
---------EAMALIDRMV-AKG--CQPDLVTYGVVVNGLCKRG---DTDL--AFNLLNK
M-EQGKLEPGVL--IYNTIIDGLCKYKH-MDDALNLF-KEMET-KG-IRPNVVTYSSLIS
CLCNYGRWSDASRLLSDMIERK-----I-NPDVFTFSALIDA-----------FVK-EGK
LVEAEKLYDEMVK--RSIDPSIVTYSSLINGFCMHDRLDEAKQMF-EFMVSKHCFPDVVT
YNTLIKGFCKYKRV-------------------------------------------EEG
MEVFREMSQRGLV-----------------------------------------------
------------------------------------------------------------
--------------GNTVTYNILIQGLFQAGDCDMAQEIFKEMVSD---G-VPPNIMTY-
------NTLLDGLCKNGKLEK---AMVVFEYLQRSKMEPTIYTYNIMIEGMCKAGKVEDG
WDLFCNLS---LKGVKPDVVAYNTMISGFCRKGSK--EEADAL------------FKEMK
E-DG-TLPNSGCYNTLIRARLRDGD-REASA-----------------ELIKEMRSCGF-
AGDASTIGLVT-NMLHDGRLD---------------------------------------
-----------------KSF----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------LDML-S
>gi|15222036|ref|NP_177628.1|	   482 residues, 50 /line  482 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
MKRLFSKS---------LCTSAAGANLKPPPADSA-------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------AIAKLILSSPNTTHQDDQFLLSTKTTP
------------------------------------------------------------
---WTPNLVNSVLKRLWNHG---PKAL---QFFHFLD----NHH-REYVHDASSFDLAID
IAARLHLHPTVWSL-IHRMRSLR--I---GPSPKTFAIVAERYASAGKPD----------
---------KAVKLFLNMH-EHG--CFQDLASFNTILDVLCKSK---RVEK--AYELFRA
L-RGR-FSVDTV--TYNVILNGWCLIKR-TPKALEVL-KEMVE-RG-INPNLTTYNTMLK
GFFRAGQIRHAWEFFLEMKKRD-----C-EIDVVTYTTVVHG-----------FGV-AGE
IKRARNVFDEMIR--EGVLPSVATYNAMIQVLCKKDNVENAVVMF-EEMVRRGYEPNVTT
YNVLIRGLFHAGEF-------------------------------------------SRG
EELMQRMENEGCE-----------------------------------------------
------------------------------------------------------------
--------------PNFQTYNMMIRYYSECSEVEKALGLFEKMGSG----DCLPNLDTY-
------NILISGMFVRKRSEDMVVAGKLLLEMVERGFIPRKFTFNRVLNGLLLTGNQAFA
KEILRLQS---KSGSRLL------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------RKFRL
>gi|15222150|ref|NP_172763.1|	   517 residues, 50 /line  517 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------MHQTLGAVRLAYRSRIANLVKSGMIDNAVQVFDEMRHSS-YR
--V-FSFDYNRFIGVLVRE-SRFELAE---AIYW------DMKP-MGFSLIPFTYSRFIS
GLCKVKKFDLIDAL-LSDMETLG--F---IPDIWAFNVYLDLLCRENKVG----------
---------FAVQTFFCMV-QRG--REPDVVSYTILINGLFRAG---KVTD--AVEIWNA
M-IRSGVSPDNK--ACAALVVGLCHARK-VDLAYEMVAEEIKS-AR-VKLSTVVYNALIS
GFCKAGRIEKAEALKSYMSKIG-----C-EPDLVTYNVLLNY-----------YYD-NNM
LKRAEGVMAEMVR--SGIQLDAYSYNQLLKRHCRVSHPDKCYNFMVKEMEPRGF-CDVVS
YSTLIETFCRASNT-------------------------------------------RKA
YRLFEEMRQKGMV-----------------------------------------------
------------------------------------------------------------
--------------MNVVTYTSLIKAFLREGNSSVAKKLLDQMTEL----GLSPDRIFY-
------TTILDHLCKSGNVDK---AYGVFNDMIEHEITPDAISYNSLISGLCRSGRVTEA
IKLFEDMK---GKECCPDELTFKFIIGGLIRGKKL--SAAYKV------------WDQMM
D-KG-FTLDRDVSDTLIKASCSMS------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------ADA
>gi|15226343|ref|NP_178283.1|	   559 residues, 50 /line  559 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------MVREALQFLSRLRKSS-NL
--P-DPFTCNKHIHQLINS-NCGILSL---K---FLAYLV---S-RGYTPHRSSFNSVVS
FVCKLGQVKFAEDI-VHSMPRF-GCE----PDVISYNSLIDGHCRNGDIR----------
---------SASLVLESLRASHGFICKPDIVSFNSLFNGFSKMK---MLDE--VFVYMGV
M-L-KCCSPNVV--TYSTWIDTFCKSGE-LQLALKSF-HSMKR-DA-LSPNVVTFTCLID
GYCKAGDLEVAVSLYKEMRRVR-----M-SLNVVTYTALIDG-----------FCK-KGE
MQRAEEMYSRMVE--DRVEPNSLVYTTIIDGFFQRGDSDNAMKFL-AKMLNQGMRLDITA
YGVIISGLCGNGKL-------------------------------------------KEA
TEIVEDMEKSDLV-----------------------------------------------
------------------------------------------------------------
--------------PDMVIFTTMMNAYFKSGRMKAAVNMYHKLIER---G-FEPDVVAL-
------STMIDGIAKNGQLHE---AIVYFCIEK-----ANDVMYTVLIDALCKEGDFIEV
ERLFSKIS---EAGLVPDKFMYTSWIAGLCKQGNL--VDAFKL------------KTRMV
Q-EG-LLLDLLAYTTLIYGLASKGL-MVEAR-----------------QVFDEMLNSGI-
SPDSAVFDLLIRAYEKEGNMA---------------------------------------
-----------------AASDLLLDMQRR--------------------GLVTAVSDAD-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------CSKQCGNEVNCS
>gi|15234269|ref|NP_192906.1|	   566 residues, 50 /line  566 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
---MAAKS---------QKT--------------------------------LVLLANLI
KFPPLKAFSL----------------LNS-------------------------------
--------------------------------------------------------PNFH
EF--QHTHESISILL-RLLLSGNL--F---------------------------------
------------------------SHAQSLLLQVISGKIHSQFFTSSSLLHYLTESE---
TSKTKFRLYEVIINSYVQS-QSLNLSI---S---YFNEMV---D-NGFVPGSNCFNYLLT
FVVGSSSFNQWWSF-FNENKS--KVV----LDVYSFGILIKGCCEAGEIE----------
---------KSFDLLIELT-EFG--FSPNVVIYTTLIDGCCKKG---EIEK--AKDLFFE
M-GKLGLVANER--TYTVLINGLFKNGV-KKQGFEMY-EKMQE-DG-VFPNLYTYNCVMN
QLCKDGRTKDAFQVFDEMRERG-----V-SCNIVTYNTLIGG-----------LCR-EMK
LNEANKVVDQMKS--DGINPNLITYNTLIDGFCGVGKLGKALSLC-RDLKSRGLSPSLVT
YNILVSGFCRKGDT-------------------------------------------SGA
AKMVKEMEERGIK-----------------------------------------------
------------------------------------------------------------
--------------PSKVTYTILIDTFARSDNMEKAIQLRLSMEEL---G-LVPDVHTY-
------SVLIHGFCIKGQMNE---ASRLFKSMVEKNCEPNEVIYNTMILGYCKEGSSYRA
LKLLKEME---EKELAPNVASYRYMIEVLCKERKS--KEAERL------------VEKMI
D-SG-IDPSTSILSLI--------------------------------------------
----------SRAKNDSH------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------VSSK
>gi|15235288|ref|NP_193742.1|	   660 residues, 50 /line  660 residues, 50 /line  EMB1025 (EMBRYO DEFECTIVE 1025); binding [Arabidopsis thaliana]
MPKCPIPI---------RISFFSY-----------FLKESRILSSNPVNFSIHLRFSSSV
SVSPNPSMEV----------------VENPLEAPI-------------------------
------------------------------------------------------------
------------------------------------------------------------
------SEKMFKSAPKMG---SFKLGDSTLSSMIESYANSGDFDSVEKLLSRIRLEN-RV
---IIERSFIVVFRAYGKAHLPDKAVD---LFH-------RMVDEFRCKRSVKSFNSVLN
VIINEGLYHRGLEF-YDYVVNS-NMNMNISPNGLSFNLVIKALCKLRFVD----------
---------RAIEVFRGMP-ERK--CLPDGYTYCTLMDGLCKEE---RIDE--AVLLLDE
M-QSEGCSPSPV--IYNVLIDGLCKKGD-LTRVTKLV-DNMFLK--GCVPNEVTYNTLIH
GLCLKGKLDKAVSLLERMVSSK-----C-IPNDVTYGTLING-----------LVK-QRR
ATDAVRLLSSMEE--RGYHLNQHIYSVLISGLFKEGKAEEAMSLW-RKMAEKGCKPNIVV
YSVLVDGLCREGKP-------------------------------------------NEA
KEILNRMIASGCL-----------------------------------------------
------------------------------------------------------------
--------------PNAYTYSSLMKGFFKTGLCEEAVQVWKEMDKT----GCSRNKFCY-
------SVLIDGLCGVGRVKE---AMMVWSKMLTIGIKPDTVAYSSIIKGLCGIGSMDAA
LKLYHEMLCQEEPKSQPDVVTYNILLDGLCMQKDI--SRAVDL------------LNSML
D-RG-CDPDVITCNTFLNTLSEKSNSCDKGR-----------------------------
------------------------------------------------------------
--------------------SFLEELVVRLLKRQRVSGACTIVEVMLGKYLAPKTSTWAM
IVR---------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------EIC
KPKKINAAIDKCWRNLCT
>gi|15237575|ref|NP_198933.1|	   527 residues, 50 /line  527 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
MAMRFFQL---------HRNRL-------------------VKGNSGKALSFSRLL----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------DLSFWVRAFCNYREILRNGLHSLQFNEALDLFTHMVESR-PL
--P-SIIDFTKLLNVIAKM-KKFDVVI---N---LCDHLQ---I-MGVSHDLYTCNLLMN
CFCQSSQPYLASSF-LGKMMKL-GFE----PDIVTFTSLINGFCLGNRME----------
---------EAMSMVNQMV-EMG--IKPDVVMYTTIIDSLCKNG---HVNY--ALSLFDQ
M-ENYGIRPDVV--MYTSLVNGLCNSGR-WRDADSLL-RGMTK-RK-IKPDVITFNALID
AFVKEGKFLDAEELYNEMIRMS-----I-APNIFTYTSLING-----------FCM-EGC
VDEARQMFYLMET--KGCFPDVVAYTSLINGFCKCKKVDDAMKIF-YEMSQKGLTGNTIT
YTTLIQGFGQVGKP-------------------------------------------NVA
QEVFSHMVSRGVP-----------------------------------------------
------------------------------------------------------------
--------------PNIRTYNVLLHCLCYNGKVKKALMIFEDMQKREMDG-VAPNIWTY-
------NVLLHGLCYNGKLEK---ALMVFEDMRKREMDIG--------------------
------------------IITYTIIIQGMCKAGKV--KNAVNL------------FCSLP
S-KG-VKPNVVTYTTMISGLFREGL-KHEAH-----------------VLFRKMKEDGV-
S-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------
>gi|18397002|ref|NP_566237.1|	   602 residues, 50 /line  602 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
MTPLSSEL---------VGFTIPFYSKTQKPYSNS--------------SHGLLLSHNRS
SLLTFSNSNP----------------N--------------------------------N
DNGRSFSSS---------GARNLQTTTTTDATLPTERRQQ--------------------
------------------------------------------------------------
--------------------------------------------------------H-SQ
SLGFRDTQMLKIFHRSCRS-GNYIESL---H---LLETMV---R-KGYNPDVILCTKLIK
GFFTLRNIPKAVRV-MEILEKF-G-----QPDVFAYNALINGFCKMNRID----------
---------DATRVLDRMR-SKD--FSPDTVTYNIMIGSLCSRG---KLDL--ALKVLNQ
L-LSDNCQPTVI--TYTILIEATMLEGG-VDEALKLM-DEMLS-RG-LKPDMFTYNTIIR
GMCKEGMVDRAFEMVRNLELKG-----C-EPDVISYNILLRA-----------LLN-QGK
WEEGEKLMTKMFS--EKCDPNVVTYSILITTLCRDGKIEEAMNLL-KLMKEKGLTPDAYS
YDPLIAAFCREGRL-------------------------------------------DVA
IEFLETMISDGCL-----------------------------------------------
------------------------------------------------------------
--------------PDIVNYNTVLATLCKNGKADQALEIFGKLGEV---G-CSPNSSSY-
------NTMFSALWSSGDKIR---ALHMILEMMSNGIDPDEITYNSMISCLCREGMVDEA
FELLVDMR---SCEFHPSVVTYNIVLLGFCKAHRI--EDAINV------------LESMV
G-NG-CRPNETTYTVLIEGIGFAGY-RAEAM-----------------ELANDLVRIDA-
ISEYSFKRL---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------H
RTFPLLNVLQRSSQTFGY


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.