FANDOM


In the plant Arabidopsis thaliana, At2g01300.1 is a gene model for the locus At2g01300.[1]

This gene model is classified by TAIR as "similar to unknown protein [Arabidopsis thaliana] (TAIR:AT1G15010.1); similar to Os05g0516700 [Oryza sativa (japonica cultivar-group)] (GB:NP_001056047.1); similar to Os01g0121500 [Oryza sativa (japonica cultivar-group)] (GB:NP_001041876.1); similar to Os01g0121600 [Oryza sativa (japonica cultivar-group)] (GB:NP_001041877.1)". It is located on chr2, region 151220-151690 REVERSE.

Physiological functionEdit

At2g01300.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g01300.1/Expression

Subcellular localizationEdit

At2g01300.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g01300.1 has 156 amino-acid residues and a molecular weight Mw = 17.624 kDa.

The protein is relatively basic; at the physiological pH 7.4, its net charge is 6.55, or 0.042 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g01300.1/Knockout

Protein interactionsEdit

At2g01300.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g01300.1 has no known domains._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g01300.1
MEATLFSSPP SISPLRFHPL VLSQRAIIPK KKKMTMRVSA AASSGKDHYY GGGRLVDENM IVLRKRIHEM KMVERNYEPP SHWMDWEKRF YNSYDSVICD SVGLLQSFLM NSRPTVAIAT LLFLLVSVPV SSTVIAFRLI DLLHWLLAAA TSAHVA
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.