&&&&&&&&&&&&&&&&&&&& BEGIN /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&& Successfully read 2 file paths from WYRM_file_paths.txt generic_input /usr/local/www/html/proteins/workspace/ generic_output /usr/local/www/html/proteins/htdocs/results/ ====================================================== Sequence file type = 3 Sequence type = 3 Got here 1 Got here 2 Got here 3 Sequence 1 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Sequence 2 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Got here 3 Got here 4 Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g01220-2_1nup_A.pir.txt ====================================================== Assigned types to 388 residues in Sequence 2-01220-2, 41 remain unknown Assigned types to 213 residues in Sequence 1nupA, 216 remain unknown ====================================================== Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat ====================================================== Translated sequence file At2g01220-2_1nup_A.pir.txt into sequence alignment. ====================================================== >1NUP.pdb Made from 3405 ATOM records in 1NUP.pdb SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDT YGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHS KLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDP KGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDA VITYIKDHGLYTKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMY QVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQ WMETVKVLRHHHSKLLRVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEK FGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRAL GQGQSVKYLIPDAVITYIKDHGLYT ====================================================== Best alignment: 1NUP.pdb 7 LLACGSFNPITNMHLRMFEVA 27 ++ GSFNP+ HL++ EVA 2-01220-2 216 IILPGSFNPLHEGHLKLLEVA 236 ====================================================== Highlighted IDENTICAL residue GLY 13 index1 11 path 220 %Seq 100.00 Highlighted IDENTICAL residue SER 14 index1 12 path 221 %Seq 100.00 Highlighted IDENTICAL residue PHE 15 index1 13 path 222 %Seq 100.00 Highlighted IDENTICAL residue ASN 16 index1 14 path 223 %Seq 100.00 Highlighted IDENTICAL residue PRO 17 index1 15 path 224 %Seq 100.00 Highlighted IDENTICAL residue HIS 22 index1 20 path 229 %Seq 100.00 Highlighted IDENTICAL residue LEU 23 index1 21 path 230 %Seq 100.00 Highlighted IDENTICAL residue GLU 27 index1 25 path 234 %Seq 100.00 Highlighted IDENTICAL residue VAL 28 index1 26 path 235 %Seq 100.00 Highlighted IDENTICAL residue ALA 29 index1 27 path 236 %Seq 100.00 Highlighted 10 residues for visualization Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g01220-2_1nup_A.pir.txt.1NUP.pdb.conservation.pml =============================================================================== The program /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g01220-2_1nup_A.pir.txt PIR amino_acid 1NUP.pdb _ 100.0 BLOSUM62.dat completed successfully. @@@@@@@@@@@@@@@@@@@@ END /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@
Advertisement
47,920
pages
At2g01220.2/Structure
Advertisement