FANDOM


>gi|30677893|ref|NP_849920.1|	   388 residues, 50 /line  nucleotidyltransferase [Arabidopsis thaliana]
--------MGDAAIRTVVEAI----------------------HSSPTQAVVYLCGGASL
ALGW--LMSVPGASNTLLE--SVVPYSRVSMVQLLG-RVP----SQHCSQALAKEMALLA
YNRALKLSK-------------PGYPVLGVGFTGSLVTS-RPKRG-DHRFFLSMRASDRI
LESSVTLTK-NLRSREEEDKVSS--------CALIQAMAKACQVSGTLDSG---------
-LTESEVPYESETH------FTEEQELE---QLINGHL------CCKIYPFSGEAHGS--
-------------DEDRKIILPGSFNPLHEGHLKLLEVAMSVCGGGY-------------
-----------PCFEISAINADKP-P----------------------------------
---------------------------------LTIA-QIKD--------------RV-K
QFEVV--------------------------------------------GKTIIVSNQPY
FYKKA-------------------------------------------------------
---------------------------------E-LFPGSSFVIGADTAARLVNPKYYEG
SIKRMLE--------IL-----GDC-----KRTGCTFLVGGRNVDG---VFKVLEDVDI-
---------------------------PEEIIDMFISI-PADIFRMD---------ISST
EIRKKQGGGT--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------N>gi|106894264|ref|ZP_01361385.1|	   413 residues, 50 /line  Competence-damaged protein [Clostridium sp. OhILAs]
-------------------------MRAEIISIGTELLLGEIINTNAQYIARELASLGID
VYHQSVIGDNETRLSEAFE-TAFKRS----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------DVVITTGGLGPTKDDMTKETAASFFGKKLIP-------------
-------------------------------HEESLKKIEAYFKGRGLNVNEGNRKQGYF
PEGSIVLP---NPNGTAPACIIE-ENNKKLILL--PGPPREM---------------IPL
FETQVLPYLKKFQDKFFS-------FKVLNVCGIGEGEMEEAIMDIV--DHQTNPTVAPY
AKPNGLTLRIAASGHTQKEADELIHPMEEQIRERLGLNIYGEDDISLEEIVAKILIEKKL
TISIAESCTGGFLSGRLVNYPGISSVFMEGIVTY-SNESKVKYLGVNPQTIEKYGAVSEE
------------------------------VAREMAEGICKSAHTNIG------------
---------------LSVTGLAGPSGGREDKPIGLVYVG--ICINGV---------TTVK
ELNLGGSR------NRIRSLATTYTLDLLRREVL--------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------NRS----L
>gi|19704467|ref|NP_604029.1|	   193 residues, 50 /line  Nicotinamide-nucleotide adenylyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------MKIAIYGGSFNPMHIGHEKIVDYVLKNLDMDK-------------
---------------------------------------IIIIPVGIPS-----------
---------HR--------------------ENNLE--QSDT--------------RL-K
ICKEIFKNNK-----------KV-EVSDIEIKAEGKSYTYDTLLKLIEI-----------
------------------------------------------------------------
---------------------------------YGKDNEFFEIIGEDSLKNLKTWRNYKE
L------------------------------LNLCKFIVFRRKDDKNIE-----------
--------------------------IDNEFLNNKNII-ILENEYYN---------ISST
EIRNKVKNKE----DISGLVNKKVKKLIEKEYID--------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|6319802|ref|NP_009883.1|	   258 residues, 50 /line  Putative protein of unknown function [Saccharomyces cerevisiae]
---------------------------------MKKTFEQFR------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------KSNLLFQVLKG-----------
---------PQHLECQKLFVLDSSFNPPHLAHFQLLSQTIKNFKLKD-------------
-------TRSHVLLLLAVNNADKL-P--KPASFPTRLEMMCLFADYLQEK----------
--------------------------------------------------------LPQS
VVSVGLTVFS-----------KF-IDKDKI---------------LHEQ-----------
----------------------FVK-----------------------------------
----------------------------------GCSADIGYLVGFDTIARIFDEKYYHP
LK---------------ISDVMESFMS------GSQLYCLARGDCHL------------S
AES----QLRYASDILEGKFEPV---IPREWGARIHVMQNDYPALRN---------VSSS
EIRNKLKNGQV--ESLKDELPLCIYDYLINNKTIFD------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|51892781|ref|YP_075472.1|	   426 residues, 50 /line  competence-damage inducible protein [Symbiobacterium thermophilum IAM 14863]
-------------------------MIAELVFVGTELLLGEILNTNAQYLSRQLAQLGVD
VYHQVVVGDNAARLRAVLS-QALSRS----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------DLVIASGGLGPTDDDITREVAAEVTGRPLEL-------------
-------------------------------DPQLLAQLEIWFARRGRRMAENNRRQCMV
PRGARVLP---NDRGTAPGLMIPADGDKVVILL--PGPPGEL---------------RPM
FEAHVAPYLAARSGGRPL----RLVTRTLRFVGIGESALADGLRDLM--ATQTDPTIAPY
AKVAEVHLRLATRAADEAEGYARIAPLEAEIRSRFGRFLYGSDEETLPQAVGRLLAERGM
TLSTAESCTGGLVAKWITDVPGSSRYFGTGFVTY-ANEAKVSLLGVPEELLSAHGAVSEP
------------------------------VARAMAEGALQRSGADVA------------
---------------VAVSGIAGPDGGTPEKPVGTVCFA--LAGRGRQGGGPLPAGTWAE
TLWLHGDR------DGVRERAAVHALAMVRRYLLG-------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------YLD
>gi|91202924|emb|CAJ72563.1|	   205 residues, 50 /line  similar to nicotinic acid mononucleotide adenylyltransferase, NAD(P) requiring [Candidatus Kuenenia stuttgartiensis]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------MMNIGIFGGSFNPIHIGHLIVAEEVFQQRKLSK-------------
---------------------------------------ILFIPTGISP-----------
---------HK--------------------ESGGLI-DSFH--------------RY-E
MVKQAIGDNE-----------HF-EVSDIEIKRPGKSYTIDTIKILRET-----------
------------------------------------------------------------
---------------------------------YGPGSNLFLILGTDMINEINTWKDIEE
L------------------------------SCMCHFIVVNRFPITLN------------
---GEIIKKSAIS-------------GEKKAEIEKL---MVQIPSLD---------ISST
EIRKKLSKGL----SIKYLVPERVENYIRKHSLYAKR-----------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|46199770|ref|YP_005437.1|	   394 residues, 50 /line  competence-damage protein cinA [Thermus thermophilus HB27]
------------------------MERAEILGVGTELLYGETLDTNTAEIARSLKPYALK
VERTLRVADEVAPLAREVE-EAFARA----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------RLVVLSGGLGPTPDDVTREAVALALGEPLEL-------------
-------------------------------DEAVLGEIEAFFRARGRAMPEANRKQAMR
IPSATWLK---NPRGTAPGWWVR-KGGKDLVLL--PGPPPEW---------------RPM
WQE-VLPCLGLPRRP--------YAERVLKTWGIGESEIVERLGPLF--VRGEEVEVGTY
PKVHGVEVVVRGR-------EDRVAELAERIKKKLLKEVWGEGEMTLAEAVKRRMEREGA
TLSTMESLTGGLLGAEITRVPGASRFYLGGVVSY-SVGAKAR-FGVPQDLLSR--TVSAE
------------------------------TARAMAEAARSLFGSTYA------------
---------------LATTGVAGPDP-LEGEPPGTVYVA--LAGPTG---------AEVR
RYRFPGDR------ETVRLRSVYAALALLV------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------T
>gi|114772126|ref|ZP_01449509.1|	   210 residues, 50 /line  Nicotinic acid mononucleotide adenylyltransferase [alpha proteobacterium HTCC2255]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------MNKTPIYLFGGSFNPPHQGHINLLLDLQSQYQIDT-------------
---------------------------------------ITLLPNAISP-----------
---------LK--------------------VDTPPV-ANHH--------------RL-N
MLELCISEHP-----------NL-CIDDYELHQTQPSYTVNTLTHFARH-----------
------------------------------------------------------------
---------------------------------Y----QVFFIIGYDSYITLPKWYQLDS
I------------------LSL------------CHLIVLPRTISKQI------------
-------PHQLPQHIVQNTTTQKNG-PITYQTGRIT---HVDLPKVN---------ISST
QCRKDLQNHS----RESQLIIPSVLNYIREHNLY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------ED-----
>gi|118618357|ref|YP_906689.1|	   429 residues, 50 /line  competence/damage-inducible protein CinA [Mycobacterium ulcerans Agy99]
-----------------MRRLRPVSARAGIVVTGTEVLTGRVQDRNGPWIADQLLELGVE
LAHITICGDRPADIGAQLRFMADQDLDLIITSGGLG-PTADD--------MTVEVVARFC
GRELILDTKLEDT-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------IANILKRLMARNPGFDPGNFDSVLAAN-----------------------
------------------------------------------------------QKQAMV
PAGAQVI----NPVGTAPGLVVP-GKPAVVVL---PGPPREL--------------QPMW
HSAIQMPGAQEAIAGRTT-----YRQETIRMFGLPESGLAATLRSAET-TIPDFGALEIT
TCLRRGEIEMVTR--YELGAADTYAQVARLLRDRHGDQIYSEDGSQVDDLVARLLAD--R
RIATAESCTAGLLAARLTDRPGSSAYVMGGVVSY-SNEAKAELLGVDPALIEMHGAVSEP
------------------------------VAQAMAAGAFQRFGADTA------------
---------------VAITGIAGPGGGTEQKPVGTVCFCV-LVGDGR---------NVTR
TLRLPGNR------SDIRERSTTVAMHLLRRALS--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------E
>gi|127511132|ref|YP_001092329.1|	   424 residues, 50 /line  competence/damage-inducible protein CinA [Shewanella loihica PV-4]
-------------------------MKIEMICTGEEVLSGQIVDTNAAWAANALMDHGIE
MQQRITVGDRLDDLVEVFR-QRSEHA----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------DVILVNGGLGPTSDDMSSEAMAIAKGEPLVE-------------
-------------------------------CTLWRERIQEWFTRNGRHMPESNLKQAML
PASAIMVD---NPVGTACGFRVK-LNRAWLFFTPG--VPFEF---------------KKM
VTEQFIPFVEQIADSHIE-----VEVQKLLTIGQGESALADKLEGM---PLPDGMTLGYR
SFMPYIEIKLFARG--EAAIGE-LDRVKAEVLTRLGDAVVGHNVASLAQVIHNGLLASGK
RLSIAESCTGGMIANNLVAFAGSSNYLDQGLVTY-SNESKVRVLGVKPATLDDHGAVSIA
------------------------------TVEEMAKGARGLLDSDYA------------
---------------LATSGIAGPDGGSEAKPVGTVAIA--LATRQG---------VYSQ
MLKFPARSR-----ELVRQLSTAVALDMLRRELQE-------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------SPVLVDYSSY---PR--FAR
>gi|146296820|ref|YP_001180591.1|	   196 residues, 50 /line  nicotinate (nicotinamide) nucleotide adenylyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------MKVAIFGGTFNPIHIGHLIMAQYVKNFSEVDR-------------
---------------------------------------VIFVPNGVPP-----------
---------HK--------------------NVDIA--LPED--------------RF-E
MVKLSIEDNP-----------DF-EISDFEIKNKEPSWTINTLNYFATS-----------
------------------------------------------------------------
---------------------------------Y---EKVYFILGSDNLFEIIKWYRAEE
I------------------------------LKKFPIIVLPRERNTTL-IRRQIEE----
--------------------------LGIQFSAKMV---LIDMPIID---------ISST
EIRRLIRENK----SIRYMVHPKVEEYIIRKGLY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------KE-----
>gi|116624935|ref|YP_827091.1|	   209 residues, 50 /line  cytidylyltransferase [Solibacter usitatus Ellin6076]
------------------------------------------------------------
----MEFFRRA-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------AGRPTRLAIFPGSFNPVTVAHVALAEAALNVA--DE-------------
---------------------------------------VVFVLPRVFP-----------
---------HK--------------------LY-EGA-KFAE--------------RA-E
ILCLALNDRA-----------NF-SIAASEG-----GLFAEIAEECRHA-----------
------------------------------------------------------------
---------------------------------Y-GDIQLSFLCGRDAAERIANWDYGEP
GAFPAM-------------LRR------------FDFLVAARSGRYLP------------
---NEAHK------------------------ESFTAL-DVPAGLDH---------VSAT
EIRARIARGE----HWEHLVPPAVQQRVRE--IYRQ------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------ANPTVP--------E--GSG
>gi|145354257|ref|XP_001421407.1|	   435 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
---------MEPGIRAIVETI----------------------HASKVRAVLHVTGGGAR
ALGW--LTSVPRCSNTLLD--ARVPYARESALETLG-RATDDDVESYCSREVAEALASAA
YARAVRHGSSR-----ATASASDARATTGLGATCALTTEDVVKRG-DHRCFVAAKTLGRM
TTYEMRLEKTSGRSRFDEEGCAS--------RLVLRALYEEARRSVDDADADAGVDLVRE
VLSEREFDEVSVTTMEDSAYANASDARAVVERWLAEDDSSTSGAT----------TAAPM
ILEFTGGVLTAVGATRANVVLSGSFNPLHDGHRDLLAAATATKPPGA-------------
----------LGAYEIGVTNADKG-T----------------------------------
---------------------------------LSID-EIMR--------------RL-E
QFSTP--------------------------------------------GTVCLLTKTPL
FVDKT-------------------------------------------------------
---------------------------------R-AAPGAAFVVGADTAARLLDPKYAGS
DA-ALDE--------SL-----NEI-----RANACDFLVAGRVDRVSRA-FVPAADVLA-
-----------------------AA-AARRAADLFAAL---PSFRVD---------VSST
EIRNAARDSGR-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------D
>gi|71649533|ref|XP_813485.1|	   425 residues, 50 /line  hypothetical protein [Trypanosoma cruzi strain CL Brener]
---------MAIPPHGFIEAI----------------------HASPLRCVLYVMGAGSS
AIAQ--LTSVAGCSRTLLD--ARVPYAMAAALQMLD-DQP----PKMVSATVARQMAQHA
HHRAVEYSNGD-----------DDGTLVGIGSTSAVQTN-RIRHG-KDSAFVAAWSQRQV
VEFAMELP--GHLARAEQEEQVT--------LLLFKALAECAKVPFEISFVVEPKR----
-ISY----------------IVPDSPLR---RLLQGEM------KFLVFNTYGELRANFV
PYVAETSFAVKPENSWKALLFPGSFRPLHWGHTELARAAVRAMATMKGTLNSTSTDTSSP
SWNVPDASNVQVTYEIAVDNADKG-I----------------------------------
---------------------------------IDSDVELKK--------------RV-Q
QFLQRG--------------------------------------------ARVAVTRARL
FTEKA-------------------------------------------------------
---------------------------------L-LFPGHGFIVGIDTMKRILDPKYYDN
SREAMLR--------AM-----EFI-----REQGGYFVVAGRASGGKDAVWEDLTSIEV-
---------------------------PAEVESMLISI-RKEDFCVD---------VSST
MLRERNKST---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------C
>gi|87306561|ref|ZP_01088708.1|	   370 residues, 50 /line  hypothetical protein DSM3645_09517 [Blastopirellula marina DSM 3645]
---------------------------------------------------MAVAGGGSE
AISR--LLQVPGASLTLLE--ATVPYSSIALTDLLK-RTP----EQYCSEATARAMAVSA
FLRARKLWQKAV---ESGLASGEQPPLMGVGCTASLKSH-RAKKG-PHRVHLAIQTPEAT
TVANLVLTK-EARTRDEEEKLTA--------ELILDRLAAAAGLTETLRLS---------
-LLPGEQIDETV--------YRAQPSWR---ELLQGDI-------------RACV-----
-----GAGETVSPSENSGVVMSGAFNPLHEGHLEMAAVAEQILGRP--------------
-----------VEYEISIENVEKP-P----------------------------------
---------------------------------LDFG-EMAE--------------RV-D
QFEPPQ---------------------------------------------RCWLTRAPT
FVEKS-------------------------------------------------------
---------------------------------R-IFPETTFVVGADTIVRIADLRYYND
SEKKRDA--------AI-----REF-----NEQNCRFLVFPRQVKG--E-FTTLEEIEL-
---------------------------PTALRRLSDGV-SPAMFRAD---------ISST
EIRRRISEL---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------G
>gi|111066068|gb|EAT87188.1|	   306 residues, 50 /line  hypothetical protein SNOG_04797 [Phaeosphaeria nodorum SN15]
---------------------M--ASRIAAIR--------------------AILPDLES
ALHS--------------------------------------------------------
------------------------------------------------------------
--------------------------------------FT--------------------
--------------------------------------ASPSKFRVVRTV----------
--------NATNTQPRTLYILDSSFNPPSIAHLTLATSALKQHAPSE-------------
------AAPYRLLLLFSTHNADKA-P--SPASFVQRLALMTVFAEDLSR-----------
---------HL--------------------KSEESTQK-EH--------------VADM
SIDIGLTKEP-----------YY-SDKSAAIKDTTPPF----------Y-----------
------------------------------------------------------------
---------------------------------S-SNPIHVHLVGYDTLIRFCNPKYYPK
YDP--------------PLSALRPF-----FDAGHKLRVTQRPADPSD---QSSSEFG-T
VQE----QEKYVQRLRDGE-EEKNG-FLPAWGNNIDMA--PAERGVG---------ISST
RVRNAAKDAKW--DVVSELCTEGVAAWIKDQSLYSED-----------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------ASGKK----MMA
>gi|145847905|gb|EDK24823.1|	   205 residues, 50 /line  hypothetical protein RUMTOR_01089 [Ruminococcus torques ATCC 27756]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------MRIGVMGGTFDPIHIGHLLLAEFAYEDFKLDE-------------
---------------------------------------IWFLPNGNPP-----------
---------HK--------------------KTDESKKALAH--------------RI-K
MIELAISDMP-----------HF-KIDLSEAETDVHSYTYSTMQKFNRM-----------
------------------------------------------------------------
---------------------------------Y-PECEFYFILGADSLFAIEEWRYFKE
I------------------FPT------------CTILAAMRDDK----------DVR-T
MQE----QISYLK---------------ERYGAKIE---LLRAPLLE---------ISST
TIRKRAAMRR----GIRYIVPDSVSNYIKEHELYQT------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------N----EFL
>gi|31544621|ref|NP_853199.1|	   366 residues, 50 /line  hypothetical protein MGA_0052 [Mycoplasma gallisepticum R]
------------------------MTM---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------KKIIIFGGSFNPIHNGHVNIATKALEQIKADR-------------
---------------------------------------IYFVPTYKST-----------
---------FK--------------------QAFNISD--IH--------------RK-K
MIQNIIKLND-----------RF-HFNWYELNIQNEK-SYLTVKYFKKK-----------
------------------------------------------------------------
---------------------------------F-ANAQIYFLIGSDNLEKFHLWDEAEM
M------------------AKDCQM-----L-----------YYL----------RDN-Q
FSDHENIKK-------------------------FNFL-KIDGDNYQ---------ISST
KIRNGT--------QVIGCVSDKNLAYINEHGLYINDRLKHFLRSDERFEHCLRVGQLAR
KLAQYNYPNLAQKAYIAGCYHDLAKELDEKTMLSYRDQFDPKLFPEPYKKDLNYRVLHGY
VGAWILEHQFGYDDRELINSIYYHTIINDDPTPLDKIVYLADKLEPDRVKQEINRYFKIN
KAKALAFKNIHQAFKLTHDEIRKYL----------QLSQK----QES
>gi|67484066|ref|XP_657253.1|	   331 residues, 50 /line  conserved hypothetical protein [Entamoeba histolytica HM-1:IMSS]
---------------------M--NYINASI----------------------CVDCSIN
LLHV--LSHIPSIIIPVKI--ENIQVKDVCLEASRG-LVP----LL-SYPSNTTYIAVCI
SSNA------IAIRDPI--------RLLYAEGSTVLNQLDILLTTFQKLPETPTG-----
------------NIALASLQIHY--------INYVDSFFK--------------------
--------------------------------------NNNGVFCIELNG----------
--------SITHSIPQCPIVYCGTFNPFHKAHKKIIEYMSMRFNHRP-------------
---------------------------------------IILDISQRSE-----------
---------DK--------------------SVTSLTN--VF--------------IRAS
QVAGK-----------------------YKVNISNTS-LYIDKCKTYPG-----------
------------------------------------------------------------
---------------------------------G-TFVVGLDTAVRILNKRYYQNSEINL
K------------------KAMQVI-----ASMGCNFIVVGRKDD----------ITN-R
FLEFDSVKSTLPA---------------KEYHYLFISL-NEKEFRYD---------LSST
YLRANG--------II--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------I----------NKNIL----PKL
>gi|134111749|ref|XP_775410.1|	   334 residues, 50 /line  hypothetical protein CNBE1260 [Cryptococcus neoformans var. neoformans B-3501A]
------------------MLYG--GSPNPSS----------------------RDSAGSN
LSHL--FFSIAA------------------------------------------------
---------------------------------ALYTLLSLIIHACTGVMA---------
------------PRRMPIARASL--------QAAIEH-IS--------------------
--------------------------------------STPGSFSLVDADDGWPF-----
--------PRDSRSGIHLAILDSSFNPPTFAHQAIISSSYPVKA----------------
------KPYTARLLLYTPKNAAKT-PTASDATPLQRLEMMSLLSSSLRS-----------
---------LQ--------------------A--------SK--------------TQQE
SIATALIHAP-----------TF-VAKASILRSY-----LVNELNLGQR-----------
------------------------------------------------------------
---------------------------------G-EEAELSFLVGMDTLLRIFDPKYYPE
GE---------------MRTKLEGFFLPPPRGAGANLVSARR-----------GTTLA-D
RE--------FEENLLKRD-D---V-KPWVENGKVRVLGDGRDGWEN---------VSST
LVRERVRKSDW--ESVNKLLGEGMSMYIQKEGLYFAS-----------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------N
>gi|146273267|dbj|BAF59016.1|	   201 residues, 50 /line  nicotinic acid mononucleotide adenylyltransferase [Pelotomaculum thermopropionicum SI]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------MRRIGIMGGTFDPIHYGHLVAAEGARYEFGLNR-------------
---------------------------------------VIFIPAGRPP-----------
---------HK--------------------PDCNIT-DPSH--------------RY-K
MTCLAVATNP-----------FF-QVSALEVERPGPSYTIDTVQEISRL-----------
------------------------------------------------------------
---------------------------------Y-PDAEVFFITGSDAVMEILTWKNFER
L------------------LSI------------CFFIAAARPGYKLN---ELWK-----
-------RLVLLP---------------ENLKERIF---CMEVPALA---------ISST
DIRQRVSEGR----PIKYLLPEPVEDYIQKNGLYRQ------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|51246439|ref|YP_066323.1|	   216 residues, 50 /line  similar to nicotinate-nucleotide adenylyltransferase [Desulfotalea psychrophila LSv54]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------MLWKKMKKIGLFGGTFNPLHNGHLQLAEFAAAQCQLDQ-------------
---------------------------------------VVFLPAASPP-----------
---------HK--------------------KGDEIV-PFSH--------------RA-E
MIRLACSRNK-----------RF-SCNTIEQDLARPSYTVDTLQALKTS-----------
----------------------PLY-----------------------------------
---------------------------------K-SEAQFFFLIGVDAFIELKTWKAYRD
L------------------LSE------------INFILCPRKLFSRT---QTVLFLT-E
LGF------------------VQTP-LGWEHSSYLTLY-ELEGAPDQ---------VSST
EVRRTFEKSG----DLYQKLPPTVADYIMKHGLY--------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|53687301|ref|ZP_00106950.2|	   208 residues, 50 /line  COG1057: Nicotinic acid mononucleotide adenylyltransferase [Nostoc punctiforme PCC 73102]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------MQQLAIFGGTFDPIHWGHLLIAETAMQEVSLEK-------------
---------------------------------------VIWVPSLNPP-----------
---------HK--------------------EAA----LFEH--------------RV-E
MLQLAIKDNP-----------AF-TVSLVEANRSGTSYAINTLIDLSAC-----------
------------------------------------------------------------
---------------------------------Y-PNTHWYWIVGLDTFQTLPRWYRGHE
L------------------AQM------------CDWLIAPRLLGGET---ITQSKLI-C
KQ------------------VEQQM-REQSYTIYWQ---LLNIPLVG---------VSSS
LIRKLCRERQ----SIRYLVPEAVRSYITNNSFYSNK-----------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------SE
>gi|37524458|ref|NP_927802.1|	   208 residues, 50 /line  hypothetical protein plu0449 [Photorhabdus luminescens subsp. laumondii TTO1]
---------------------M--NMPDKNER--------------------YLIDLING
KL----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------NYIHIDRNGDF-----
--------NNTNIDWKETLILSGSFNPLHKGHEELKEIATAMTKRKP-------------
------------YYELSIKNAVKL-T----------------------------------
------------------------------------------------------------
-----ISTDE-----------IF-E-RIRQFKGKGDIVLSDAKIFTEKS-----------
------------------------------------------------------------
---------------------------------H-IYQGAIFVIGADLCQEINNPIYYGG
EEG--------------LKKSLMTI-----KNNDCRFLVAGRFFNNKY---HTVDDLM-N
IR--------------------------KEHRFLFESI-PENLFRLD---------ISST
EIRLMNKE----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|91773440|ref|YP_566132.1|	   386 residues, 50 /line  Cytidyltransferase-related [Methanococcoides burtonii DSM 6242]
------------------MHIH--DSPCQLVL--------------------AATGGGAG
AIDQ--LLRYGGGSATVLE--ALVPYSSKALDELIG-KKP----EKYVSPVTVRAMAMAA
YRRALSLAGNDDGVAEK--------RLMGVAASCKLSVGDDEREGREHKIFVAIQSFDKT
LVRTLILR--KERSREEEEYIAT--------CMVVDSIAKECSWTGNLLLEELLCG----
-D---EVVEERE--------ATASKEVA---QMLALPDNIMNSLDLVSDVVQFDL-----
--------GGENVTEKPEVIFSGSFDPCHKNHIQMAEQAFNKLG-KK-------------
-----------VHFEISLTNVDKP-S----------------------------------
---------------------------------IDLI-SLQE--------------RL-D
SLRKYKDYV-----------------------FFGGVLLTVAPLFIQKV-----------
------------------------------------------------------------
---------------------------------N-LFEKATFIVGADTVNRLFKTRYYRN
VED--------------MRDMLQYF-----RNRNTHFLVFQRKGVDLE------------
--------------------------LEPDILDLCEVVPLDDYLDNG---------TSST
SIRNVVQK----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|111115615|ref|YP_710233.1|	   193 residues, 50 /line  hypothetical protein BAPKO_0832 [Borrelia afzelii PKo]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------MRIAILGGTYNPVHIGHIFLAKEIEYLLNIDK-------------
---------------------------------------IIFIPTCNPT-----------
---------HK--------------------LIGEGV-SVKN--------------RI-D
MLKLALKNEN-----------KM-FIDDCDIINGGITYTIDTISCVKKK-----------
------------------------------------------------------------
---------------------------------Y-KNDKLFLVIGDDLFQNFDSWKDPQS
I------------------ASS------------VDLVVAHRIYKER-------------
------------------------------LKSSFKHI-YIDNKIIP---------ISSS
EIRNRIANGF----PVSYLLPFGVLKYIKDNNLYVKK-----------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------VNV
>gi|20091254|ref|NP_617329.1|	   412 residues, 50 /line  hypothetical protein MA2423 [Methanosarcina acetivorans C2A]
MMVDNLAADKYSVPVESIFQIH--ESPCKIVL--------------------AITGGGAE
ILGE--LLRHGSGSATVLD--AVVPYSMEAMDRFLG-RKP----EKYCSEKTARLMAMVA
YQRALDLSKGEESAAHD---------VVGIGATCKLKAA-NERKGRKHVVHVAIQAACKT
GVITLELA--ADRTREKEEKIAA--------FLIFNVLARHSGVPEVDLPGRIGTG----
-DERKEEITEKY--------ESVSEPVG---NLLKQKICSQKGPDKTPDMARIDL-----
-----NEGKSSAEPDKVRLVFPGSFDPCHRNHVFMAKLASEKHG-EP-------------
-----------VHFEISLTNVDKP-P----------------------------------
---------------------------------IDFI-SLNQ--------------RL-D
SLRKYRDEA-----------------------FVGGVCLTNAPLFLQKA-----------
------------------------------------------------------------
---------------------------------D-LFPNSTFIIGADTFNRLFDAKYYGG
KVD--------------ISAILRHF-----REKNIRFMVFQRKSVEMS------------
--------------------------VNPEVLKFCEIVPMDEYEDDG---------ISST
EIRRKQEENKG-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------N
>gi|37523585|ref|NP_926962.1|	   206 residues, 50 /line  hypothetical protein glr4016 [Gloeobacter violaceus PCC 7421]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------MGERLGIFGGTFNPVHRGHLAMARAARDRCGLDQ-------------
---------------------------------------ILWVPAAQPP-----------
---------HK--------------------PLAGGA-SIGD--------------RV-E
MVRLAIAGEA-----------GM-ALSLVDARRPGPSYAIDTLRLLEEQ-----------
------------------------------------------------------------
---------------------------------Y-PQAQWHWLLGQDGLADLPGWYRAAE
L------------------IPR------------CRWIVVPRPGSGAD---PKQA-----
--------MADLT---------------ERFGAVFV---PLSDFECD---------ISST
RVREQLAAGR---AGWEALLPEQVVSYIHKRGLYDVP-----------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------AGA
>gi|121706767|ref|XP_001271623.1|	   328 residues, 50 /line  cytidylyltransferase, putative [Aspergillus clavatus NRRL 1]
-MTSSNII---------------------ITE--------------------SILSN---
STGS--TFSVHCTSS-----------------------------TSYHFYFPVRSMASTT
YQTLRA------------------------------------------------------
---------------------HY--------HAALKR-FI--------------------
--------------------------------------AGPRNLEVLSTIPSNQL-----
-----QEQKHPSPVPEVLYVLDSSFNPPTCAHLRIANSALLEKP----------------
------SVPSRLLLLLATQNADKP-S--KPASFEDRLAMMELFAQDLWS-----------
---------HL--------------------QTSSPAP--GN--------------AGLL
QIDIGVTKRP-----------YF-VDKAAE---------------IEKS-----------
----------------------DVY-----------------------------------
---------------------------------P-EPLEQVHLTGYDTLIRIFNPKYYPP
EH---------------TLQPLGPFLS------QHRLRVTMRPSD----------EWG-S
KEE----QEAFLLHLAQGG-RENEG-GKREWAQRIQLVEGKKPGDPA---------VSST
KAREAIHANP---QDLEWLVPDKVREYILSQRPYAE------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|16127661|ref|NP_422225.1|	   216 residues, 50 /line  nicotinic acid mononucleotide adenyltransferase [Caulobacter crescentus CB15]
-------------------MWF--AGPARLVP----------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------EAGRPNAQRLG---------
------------------------------------------------------------
---------FHLEPGMRVGLFGGSFNPAHEGHAHVAETAMRRLELDR-------------
---------------------------------------VIWLVSPQNP-----------
---------LK--------------------PTHETR-PVAE--------------RM-A
NARRWARG-S-----------GM-IVSDAET-RLGSQYTIDTLRVLRAR-----------
------------------------------------------------------------
---------------------------------Y-PGVKFVWVMGADSLATFHRWRGWTQ
I------------------MRE------------VPVAVISRPWIALK---ARTSPAA-R
R---------FAFARWPA--SAAAR-LPDAKSPAWV---YLTGPLNF---------ASST
AMRARQK-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------G
>gi|67937925|ref|ZP_00530455.1|	   198 residues, 50 /line  Cytidyltransferase-related:Probable nicotinate-nucleotide adenylyltransferase [Chlorobium phaeobacteroides BS1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------MRLAVFGGSFDPPHNGHLALCLYARELLQVDR-------------
------------LVISASNNPLKD---APQAADRDRVKMAE-------------------
------------------------------------------------------------
LLAETINRTG-----------AFAEVSSWEANRGHPVYTIDLMEYLEEI-----------
------------------------------------------------------------
---------------------------------Y-STSDLTLLIGEDNFLNFRQWKSWEE
L------------------IRR------------YSIIVFGRKADDGA---SDDSAIS-E
R----------------------------LHDQSFRH----IDLNLP---------LSST
EIRKRLASGD----DCSAEIPSPIWQYIVENQLYQ-------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|85110717|ref|XP_963597.1|	   425 residues, 50 /line  hypothetical protein [Neurospora crassa OR74A]
------------------MPHD--DDMLERSQ--------------------SLLRS---
ATSR--RHLTDFFSRALSA--FQSPSDSAQNFQVVC-TAP----P--ASSSNASCSAAGA
H-----------------------------------------------------------
----------------------------------------------------EAQG----
-KPLH-----------------------------------------------PQS-----
-----PAPIPPTKRPHTLIVLDSSFNPPTLAHLRMATSAVRDTIKKKR-----------R
GEDAKDMSGLRLLLLLAVVNADKA-P--KPAAFDQRLAMMWAFAHDVQRALRGEADKSPV
EVSPASGPGPK--------------------PEKSHIHDSSQLKAADEEQQKQGVPQVDI
SVDIGLTSKP-----------YF-HEKSRVI---------------AES-----------
----------------------EFYKPP--------------------------------
----------------------------QEEGEE-DTMEQVILVGFDTLIRIFNPKYYGP
ATQVTAHAQDQSRKGSPIQQALDPMFK------RAKLRVTLRTDD----------EWG-G
KQE----QVAYLESLLSEEGLAKIG-GSKEWAERIELVEGRRDGEEI---------VSST
YARKAAEREEW--GKLRRLVSPEVGKWIEGEKLNTLV-----------------------
------------------------------------------------------------
------------------------------------------------------------
---------------LCQQGLVAARKD-----TGNISGGL----QVA
>gi|109649277|ref|ZP_01373169.1|	   207 residues, 50 /line  nicotinate (nicotinamide) nucleotide adenylyltransferase [Desulfitobacterium hafniense DCB-2]
------------------MNIN--APPKRIG-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------IMGGTFDPLHYGHLVAAEMARHEFALE--------------
-----------KV---------------------------IFIPTGNPP-----------
---------HK--------------------VGRRVT-SSGD--------------RY-E
MVKRAVQDNS-----------FF-EVSDLEIQRKGYSYTVDTLKDMHKL-----------
------------------------------------------------------------
---------------------------------Y-PQHELYFITGADAFREIFTWREVQS
------------------------------VLSLSHFIGASRPGFDPH---EF---LE--
-------------ELKR---------DYPEFLPHMHLF---DVPALA---------ISST
DIRSRVKEGK----PIRYLLPESVRLYIEETGLY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------R-----I
>gi|146346398|gb|EDK32934.1|	   203 residues, 50 /line  nadD [Clostridium kluyveri DSM 555]
--------------------------MVKKA-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------IFGGTFDPIHNGHIHIAYEAIYRLGLD--------------
-----------EI---------------------------VFMPTGNPP-----------
---------HK--------------------AKKSIT-DAFL--------------RY-E
MVKVAIRSES-----------KF-TVSNYEVNKTTLSYTYSTLEHFNKL-----------
------------------------------------------------------------
---------------------------------E-SKTEWYFLTGADCLMDIEKWSRVDS
------------------------------IFRLCKFIVFNRPGFPAF---TSESIED--
-------------QKKK---------IEDKYSTNIIYL---DAPLFD---------ISST
VIRNSVKEGK----NVNYFLPESVCNIIKQLNLY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------K------
>gi|15895057|ref|NP_348406.1|	   201 residues, 50 /line  Predicted nucleotidyltransferase [Clostridium acetobutylicum ATCC 824]
---------------------M--HSNNIIL-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------VYGGAFNPPSASHITLAKQLLNYTGAK--------------
-----------KL---------------------------MFVPVGNQY-----------
---------KK----------------------KELI-PAYH--------------RI-N
MLQIACECNN-----------RL-EVNTTDVDFKRRLYTIETLEIIKKQ-----------
------------------------------------------------------------
---------------------------------N-SDKDIYFIIGTDNLRDILNWKHWQR
------------------------------LLTEYKIIVMDRGEDTIF---KV---FK--
-------------DIPI---------L-KKYKANLIQIP--GLLVNN---------ISST
LIRNNIRQDK----TIEHLTIKKIIKYIKENNLY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------K------
>gi|47459111|ref|YP_015973.1|	   360 residues, 50 /line  hypothetical protein MMOB2760 [Mycoplasma mobile 163K]
--------------------------MNKIG-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------IFGGSFDPIHIAHTFVAEESIKILNLD--------------
-----------KL---------------------------FFVPTFINP-----------
---------DK--------------------IGRKSA-SPED--------------RI-N
MINLVKPEKS--------------EVSLFEINRKNISYSIDTLKYFKSK-----------
------------------------------------------------------------
---------------------------------Y-PNDQLFFIIGSDNINKINKWEGIDW
------------------------------IYQNVQIVVFRREKL------------I--
-------------NKIN---------I-KKYKAILLDNK-----ILD---------YSSS
NYKK----------GNTFLVDKKVQCYIGKNLLYGQDIAINNLEA-KRYKHSVATEVMAT
KIAKKLNFDLK-AAAFSGLMHDITKNWDIEEHYKFLEEQNYPN----FNKVEKHKLHQIS
ASIW-LKNIFLVENEQIINSIGCHTTLKNDLSLLDKIVFVADKICEGR------KYEGIQ
KVRKLALENFDEAFKLVVKRTWDFNLEKNIPLSEEQINIYRK--WSQ
>gi|37522010|ref|NP_925387.1|	   426 residues, 50 /line  competence-damage inducible protein CinA homolog [Gloeobacter violaceus PCC 7421]
---------------------M--APSAEILCIGTELLLGQIVNTNAQFLAVELAKLGIP
HHFQTVVGDNPGRIRLALD-IAIERAGIILTTGGLG-PTD----DDLTH-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------QTLAEHFEVPLVRHPALLALIEERFRER--------------
-----------NR-PMSPTNAKQ-----------------ADLPEGAQI-----------
---------LPNPMGTAPGIVWE-PKAGVAILTFPGV-PAEM--------------RA-M
WAETAVPFLRLRGG-------GQ-EIFHSRTLRHWGVSESTLAEKVEEFLRGVNPTVAPY
AGNGEVKLRITARAAGIAAAESLIAPVEASLRTIAGLDCYGADEDTLASASAALLVRTGT
TLAVAESCTGGMLAEALTALPGASRYLRGAVVAY-ANDLKTSLLGVDEQRMIDHGAVSEP
------------------------------VARAMAEGVRNRLASDWG---LALTGVS--
-------------GPGG---------GTAQKPVGLVHIA--LAGPGE---------TRAV
EIRLGAQRGR----DWIRRVSTQSALDLLRREII--------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------NWEAFGIMK----ER
>gi|118582013|ref|YP_903263.1|	   221 residues, 50 /line  nicotinate (nicotinamide) nucleotide adenylyltransferase [Pelobacter propionicus DSM 2379]
--------------------MV--SPVMKIG-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------LMGGTFNPIHMAHLRIAEEARELCGLD--------------
-----------RV---------------------------LFIPVADPP-----------
---------HK--------------------PLAGEV-PFHQ--------------RC-Q
MVRLAIAGNR-----------AF-ELSEIEGQRPGKSYSIDTIGTFREQ-----------
------------------------------------------------------------
---------------------------------H-PQAELYFIIGSDSFLELGLWRRYAD
------------------------------ILRSCNLIVVERPGRQVN---DPLSALPVD
IRG----ELRYTPASRS---------LEHVGGTRVHFF---AGCLLD---------ISSS
EIRRLAATGR----SITYLVPPQVEAYIKEQRIY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------SE--C-P
>gi|118061737|ref|ZP_01530090.1|	   378 residues, 50 /line  expressed protein [Roseiflexus castenholzii DSM 13941]
-------------------MNL--IPTETIAAI----------HDTPHRLVFEFAGAGSL
ALYW--LHSVPGSSRTVLE--ATDRYAATSLTDLIG-KTP----EKFVSADTARIMAEMA
YRRAMRLTDGAA-------------ACLGVACTAAIATD-RAKRG-AHGCSIAVYDGTTM
RAFNLTLAK-GARDRAGEEQVIS--------LLIIRAIASACGVAAPDLALEPPET----
-L---EVDE-----------ETRPDPLTLL------VQ---GDVEDVFIDIDGHA-----
----------HLKGTPPVALLSGSFNPLHAGHEQLAQAAAAFLRVP--------------
-----------VV---------------------------FELPILNAD-----------
---------KP---------------------PLGYA-ELER--------------RL-E
QFRGRYP---------------------------------------------VVLSRAPL
FVQK--------------------------------------------------------
--------------------------------AN-LFPGCTFVIGYDTAIRIIDPRYYDG
EAG-RNA--------AFAAI----------AAHGCTFLVAGRIKDGVF---RTLADIDL-
---------------------------PASLRPLFRELP-ERIFRVD---------LSSS
AIRNAYG-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------T
>gi|145536882|ref|XP_001454163.1|	   398 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
---------------------------------MSYILVKQLN--DSQLIVLYTAGAGAQ
ALCH--FTLHPGSSKYAME--SSSFYAKGSLELLLN-RNI----EKFVTEQVAEDMALKA
LIRSHEILRQEYITDKYDFCSIRFNTTLGIGVTAAIRSV-NERQG-RHHAFICLNFGIAK
YTYYLDLVK-GVRTREEEDQFIS--------DILFKLIIKHSSQHQQQIKEQEEEV----
-LDKIQILE-----------NAKSMNLNLI-KSLQNQT---GLLNSILITANQYQ-----
----------LNPIVQDAIILSGSFNPIHFGHIELAKMSQQLMGLP--------------
-----------NV---------------------------YFELSIKNA-----------
---------DK--------------------QDITIQ-DVEK--------------RI-E
LMKKQN--------------------------------------------LNIILSNKAF
FKDK--------------------------------------------------------
--------------------------------NL-FLKNGAFAIGVDTYKRVVDVKYYNN
SIQERDL--------SLLLF----------LQNNNKIIVAPRYNETTQK-LETLNDYEI-
---------------------------PKILEKNVIEL---KEFRND---------ISST
KIRQSEG-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------N
>gi|39975719|ref|XP_369250.1|	   334 residues, 50 /line  hypothetical protein MGG_06214 [Magnaporthe grisea 70-15]
---------------------M--SPNVKVLDFFKEGLENFRLSQDQLEILCEAPR----
------------------------------------------------------------
------------HDAGLPLT-------QDVICNTTISTN-RKTD----------------
------------------------------------------------------------
--------------------------------------------------ALERS-----
----------KPRLPRRIIVMDASFNPPTSAHMQMATSAIRSAGDR--------------
-------RNTRLL---------------------------LLLAVSNAD-----------
---------KA----------------------PKPA-SFEQ--------------RL-A
MMNALAQDVYEEISYDDEAGAAA-PESDDNGHRFGIDLA---------------LTTLPY
FHDKSAALAAV--------VETAFEPPP--------------------------------
-------------------------------TGR-APVEQVFLIGYDTLIRLFNPKYYSR
TENGETV--------NGIREALSP------LFGRARARLTLRADADWG-----------G
REE----QLAYLENVRHGDALEQAG-GLKEWASRIDVAE-TGDAHGL---------VSST
SAREAAARGDW--VRLRELVPPRVAAWVQDERLY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------QE--S-E
>gi|81429001|ref|YP_396001.1|	   215 residues, 50 /line  Nicotinate-nucleotide adenylyltransferase (Deamido-NAD(+) pyrophosphorylase) [Lactobacillus sakei subsp. sakei 23K]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------MQNAT----
-LKKVHGVS-----------ESKPSVLVV-------------------------------
----------EDKQRQQVGIMGGTFNPPHLGHLIMAEQVGTQLGLD--------------
-----------KV---------------------------LFMPDATPP-----------
---------HV--------------------DTKKTL-PAKH--------------RV-E
MVKRAIADNP-----------LF-ELSMAEIERGGVSYTYDTIVALKKQ-----------
------------------------------------------------------------
---------------------------------Y-PNTDFYFIIGGDMVDYLPTWHRIDD
------------------------------LVQLVQFVGIQRTGYSRD------------
------------------------------TPYPVLWV---DAPLVD---------ISST
QIRNKVQQSC----SIRYLVPTKVADYIEEEGLY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------RE-----
>gi|91216318|ref|ZP_01253285.1|	   439 residues, 50 /line  hypothetical protein P700755_00572 [Psychroflexus torquis ATCC 700755]
---------MGDKDFESALSIK--DKSLRINL------------NENIYGTFAEIGAGQE
TVRN--FFRAGGSSGTIAK--TMSAYDKDFSDAIYGIEED----RRYVTESRLQKM--LD
HETNLIEERIHRSKHP-------NKLFFTYGNTVATIDF-A-KRY-KGHGWVGIKYQLKP
KSEYNKIAL-HIRFKENDARLQQNTLGTLGTNLIYAAYYAHNNPKQILNELYDHLH----
-KDQIEIDTINFSGPVFKEVDNRLMSLQLV------KN---GMTEAVMFAPDGNN-----
------ILPAKALYKKNILALRGSFRPVTKVNMDIYDTALELFEKE--------------
-------K------KVKKENIQA-----------------VFEITLSNL-----------
---------RS-------------------EGEINEE-DFMD--------------RA-K
LLCSLG--------------------------------------------HTVMISNFQE
YYKL--------------------------------------------------------
---------------------------VEYFSNY-TKERMGLAMGVNNLIDVFDEKYYRH
LSGGILE-------------AFGKL-----FFKDLRVYLYPYKDPKTEK-VTDSDNLKV-
------------------------------------------------------------
-----------------HPRMKELYKFFKHNGRVVD------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------IENYD----------KDILTLASE--S-F
>gi|146418984|ref|XP_001485457.1|	   273 residues, 50 /line  hypothetical protein PGUG_03186 [Pichia guilliermondii ATCC 6260]
------------MSQLS-------------AKSLQKTVQDFL------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------ASGSHLRIIYNPSL--------
-------DALANSNTRRICVLDSSFNPPHLGHYALIKESLSYKNQF--------------
-----PKDNQAVLLLFSVKNADKVTA--APAALEHRLAMMCLMADYVQK-----------
--------------------------------------------------------KMQV
NVSVGITDHA-----------KF-VDKSST---------------ILR------------
------------------------YLKE--------------------------------
---------------------------------QNLLAKLTFLVGFDTLLRILNPNYYLP
DK---------------ILAALSEFMG------STDLFCLTRNDE----------KL--S
VAD----QSLYVQTLRSGG--HE-D-LPSIWSQSISLHTGEIDIVGA---------MSSS
KIRKEVADGHK---EWHNEVIPEIHQYIVEQSLY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------KKL---E
>gi|19115395|ref|NP_594483.1|	   249 residues, 50 /line  hypothetical protein SPAC694.03 [Schizosaccharomyces pombe 972h-]
---------------------------MDQAKKYAN----LL------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------DSFRSSTEDILL---------
-------LERLEVSDKPIYVLDSSFNPPHFAHLGMCLSIPK-------------------
--------GSQLLLLLSITNADKP-V--APAAFNERILMMEKLKTLI-------------
---------------------------------------------------------HNC
TVSVAICKHA-----------LF-VDKCRS---------------ISN------------
------------------------KL----------------------------------
----------------------------------GPR-EQVYLVGFDTLIRILDCKYYKE
KA---------------MQQVLQPFFS------CSQILCFSREVD----------GT--T
TDD----QAQYLEKIKKSL--L-PN-IPSQWSEKIKLTKLKGNVGFG---------VSST
RARQAIISGDE--ETQRKIIPQEILNVIKVIQPY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------RHR----
>gi|50285139|ref|XP_444998.1|	   275 residues, 50 /line  unnamed protein product [Candida glabrata]
---------------------------MDYYQQYTE----FV------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------AKNGQFCLFDGSL---------
-------GVKPINSGTKVLVLDSSYNPPHLAHFTLVKNAIEFYGHR--------------
-----GFSNFHVLLLLATNNADKR-P--KPATFDKRMAMMKRFADFISI-----------
----------------------------------------------------QNWNGMQV
GVSCALTTHG-----------KF-VDKLVD---------------ISK------------
------------------------LINF--------------------------------
---------------------------------GIEMPVITFLVGFDTLIRIFNPVYYEP
VS---------------VAEALRSFME------SVEFCCLRREDG----------KY--T
LDF----QEDYINKIINGE--EEPQ-IPSNWGEKIHILSFNE-SVKN---------ISSS
MVRDVVNNKGSDAIDLKDSIPMVIVEYIKQNPSL--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------FKNDIEE
>gi|45199240|ref|NP_986269.1|	   257 residues, 50 /line  AFR721Wp [Ashbya gossypii ATCC 10895]
---------------------------MQSTRHFQL-LEESK------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------LSGTHFEIVYGKR---------
---------FLDAPERRLLVLDSSFNPPHFGHCELIERAVEHYKSE--------------
--------QLHVLLLLSVNNADKA-A--KPATFDKRLYMMSILAELLS------------
---------------------------------------------------------KSI
DSSVGLTTHA-----------RF-IEKTGA---------------IRK------------
---------------------------H--------------------------------
---------------------------------GFHVGPITYLMGFDTLIRFFDPRYYQP
ST---------------LIEALSEFMQ------HTELFCLTREDG-----------A--G
PEN----QATYCATLATGG--FEPH-MPRNWASHIFIDSRAG-KYYG---------LSST
KVRNLIAQPR----ALSDLVPKEILDYICIAGGP--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------KI--FTE
>gi|50545425|ref|XP_500250.1|	   252 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
------------MSLYTLVRAAATHSRPPAGTNFKA----EI------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------DDFMRGDERVRL---------
-------LGDMPRKGSRVVVLDSSFNPPHYAHLELAMLGMTHTKDN--------------
----------CILLLLSITNADKK-P--APAAFQQRLEMMELFKRSI-------------
----------------------------------------------------------DA
EVVLGLTKEP-----------YF-VDKYKV---------------IKR------------
------------------------LLAS--------------------------------
---------------------------------HGLTPHLHFPMGLDTLVRLVDQKYYKE
-P---------------VSEALKGFFQ------DCHVHVLTRDDI----------HF--N
M----------------------KE-LPEQWQRHIHMSKHSS-KTDG---------VSSS
NVRALVKSHKR-HHEFERLVPPQILAYIVEHGLY--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------K------
>gi|46109458|ref|XP_381787.1|	   263 residues, 50 /line  hypothetical protein FG01611.1 [Gibberella zeae PH-1]
---------------------MPSIDPKTLVSTFSRALSSFQ------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------SSPDAFRVLCTLPHTSN-----
----VPAPRRPGRPVQHLVVLDSSFNPPTLAHANMARTALGLEGHQ--------------
----------RLMLLLSVNNADKA-P--KPASFPIRLSMMEAMGRELLD-----------
----------------------------------------------------K-----GI
EIDVAVTTMP-----------FF-HDKAKA---------------ITES-----------
----------------------GFYVAE--------------------------------
---------------------------------TGEQPTQTFLAGFDTIVRIFNPKYYNE
-G---------------IRSALRPFFE------SCKVRVTTRPDE----------TWG-G
VEE----QRAWLTRER--V--KDVG-GDEAWVERVEMVEGREGDEDC---------LVHV
AV---------------------TWSWLRNEAIL--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------VCFVYCR


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.