Fandom

Proteins Wiki

At2g01220.1/MSA

< At2g01220.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|30677890|ref|NP_178231.2|	   387 residues, 50 /line  nucleotidyltransferase [Arabidopsis thaliana]
-----M---GDAAI-RTVVEAIHSSPTQAVVYLCGGASLA-LG-----------------
-----WLMSVPGASNTLLE-SVVPYSR-VSMVQLLGRVP----SQHCSQALAKEMALLAY
NRALKLSK-------------PGYPVLGVGFTGSLVTS-RPKRG-DHRFFLSMRASDRIL
ESSVTLTKNL-RSREEEDKVSSCALIQAMAKACQVSGTLDSGLTESEV-----P--YESE
THFTEEQELEQLIN--------GHLCCKIYPFSG-AHGSD---------------EDRKI
ILPGSFNPLHEG--HLKLLEVAMS-------------------------VCGG-----GY
PC---F---------------------EISAINA---------------DKPP-LTI---
--------------------------AQIK------------------------------
------------------------------------------------------------
--DRVKQFEVVGK-----------------------------------------------
---------------------TIIVSNQPY-----------------FYKKAELFPGS--
------------------SFVIGADTAARLVNPKYY------EGSIK-------------
RMLEILGDCK-----RTGCTFLVGGRNV--------DGV--FKVLEDVDIP---------
----------EEIID---MFISIPA--------------DIFRM---------DISSTEI
RKKQGGGT----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------N
>gi|106894264|ref|ZP_01361385.1|	   413 residues, 50 /line  Competence-damaged protein [Clostridium sp. OhILAs]
----------------MRAEIISIGTELLLGEIINTNAQY-IARELASLGIDVYHQS---
-----VIGDNETRLSEAFE-TAFKRSDV--------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------V
ITTGGLGPTKDDMTKETAASFFGK------------------------------KLIPHE
ESL---KKIEAYFKGRGL--------NVNEGNRK---------------QGYF-PEGSIV
LPNPNGTAPACII-EENNKKLILLPGPPREMIPLFETQV-LPYLK------------KFQ
DKFFS------------------------------------------FKVLNVCGIGEGE
MEEAIMDIVDHQTN-PTVAPYAKPNGLTLRIAASGHTQKEADELIHPMEEQIRERLGLNI
YGEDDISLEEIVAKILIEKKL-TISIAESCTGGFLSGRLVNYPGISSVFMEG------IV
T----------YSNESKVK-YLGVNPQTIEKYGAVS------EEVAREMAE---------
GICKSAHTN----------------------------------IGLSVTGL--AGPSGGR
EDKPIGL---------------VYVG-------------ICING---------VTTVKEL
NLGGSR-------NRIRSLATTYTLDLLRREVL---------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------NRS--------L
>gi|51892781|ref|YP_075472.1|	   426 residues, 50 /line  competence-damage inducible protein [Symbiobacterium thermophilum IAM 14863]
----------------MIAELVFVGTELLLGEILNTNAQY-LSRQLAQLGVDVYHQV---
-----VVGDNAARLRAVLS-QALSRSDL--------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------V
IASGGLGPTDDDITREVAAEVTGR------------------------------PLELDP
---QLLAQLEIWFARRGR--------RMAENNRR---------------QCMV-PRGARV
LPNDRGTAPGLMIPADGDKVVILLPGPPGELRPMFEAHV-APYLA------------ARS
GGRPL---------------------------------------RLVTRTLRFVGIGESA
LADGLRDLMATQTD-PTIAPYAKVAEVHLRLATRAADEAEGYARIAPLEAEIRSRFGRFL
YGSDEETLPQAVGRLLAERGM-TLSTAESCTGGLVAKWITDVPGSSRYFGTG------FV
T----------YANEAKVS-LLGVPEELLSAHGAVS------EPVARAMAE---------
GALQRSGAD----------------------------------VAVAVSGI--AGPDGGT
PEKPVGT---------------VCFA-------------LAGRGRQGGGPLPAGTWAETL
WLHGDR-------DGVRERAAVHALAMVRRYLL---------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------GYL--------D
>gi|134111749|ref|XP_775410.1|	   334 residues, 50 /line  hypothetical protein CNBE1260 [Cryptococcus neoformans var. neoformans B-3501A]
---------------------------MLYGGSPN-----PSSRDSAGSNLSHLFFSIAA
ALYTLLSLIIHACTGVMAP-RRMPIAR-ASLQAAI----EHISSTPGSFSLVDADDGWP-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------FPRDSRSGIHLA
ILDSSFNPPTFA--HQAIISSSYPVK----------------------AKPYT------A
RL---L---------------------LYTPKNA---------------AKTPTASD---
--------------------------ATPLQRLEM--------MS------------LLS
S------SLRSL----------------------------------QASKTQQE------
------------------------------------------------------------
-------------------SIATALIHAPT-----------------FVAKASILRSYLV
NELNLGQRG---EEAEL-SFLVGMDTLLRIFDPKYYPE---------------------G
EMRTKLEGFFLPPPRGAGANLVSARRGT--------TL---ADREFEENLLKRDD-----
--------VKPWVEN----GKVRVLG-----------DGRDGWE---------NVSSTLV
RERVRKSDW---ES----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------VNKLLGEGMSMYIQKE------G----LYFAS-------N
>gi|88935891|ref|ZP_01141514.1|	   420 residues, 50 /line  Competence-damaged protein:CinA, C-terminal [Geobacter uraniumreducens Rf4]
----------------MKIATLSIGDELIFGEVVDTNAAH-ISERLYSVGFKVQRQL---
-----TVGDNEQDIVEAIE-MLAVKCDV--------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------V
VVTGGLGPTVDDITARSAAKITGH------------------------------ELVLNE
---EALARLQRFSEKLGGNLHP--------SNEK---------------QALM-PANATL
IPNPVGTACGFYLT-HNGRFLFFLPGVPGEMACMLDETV-IPFIV------------SRV
KRRTF----------------------------------------LQTKVFKVFGPSEAE
VDALMDGVADEAAG-VSVAFCVNFPEIQVKLRVEGHEEAVVAELLTRAGDKARQRLNGYV
FAEDGETIDTVVASLFRETGF-TLSLAESCTGGLVAKRITDIPGSSAYFLEG------IV
T----------YSNTAKTQ-LLDVPQRLLDEKGAVS------SEVAVAMAL---------
GARKLSGSD----------------------------------IALAVTGI--AGPDGGT
AEKPVGT---------------VYMA-------------LAGSN---------GCQAKRY
TFHGDR-------EEIRLITSFMAMDWLRKRLL---------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------SLRSAEV---TD
>gi|118618357|ref|YP_906689.1|	   429 residues, 50 /line  competence/damage-inducible protein CinA [Mycobacterium ulcerans Agy99]
--------MRRLRPVSARAGIVVTGTEVLTGRVQDRNGPW-IADQLLELGVELAHIT---
-----ICGDRPADIGAQLRFMADQDLDL--------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------I
ITSGGLGPTADDMTVEVVARFCGR------------------------------ELILDT
KLEDTIANILKRLMARNPGFDPGNFDSVLAANQK---------------QAMV-PAGAQV
I-NPVGTAPGLVVP--GKPAVVVLPGPPRELQPMWHSAIQMPGAQ------------EAI
AGRTT----------------------------------------YRQETIRMFGLPESG
LAATLRSAETTIPDFGALEITTCLRRGEIEMVTRY--ELGAADTYAQVARLLRDRHGDQI
YSEDGSQVDDLVARLLADR---RIATAESCTAGLLAARLTDRPGSSAYVMGG------VV
S----------YSNEAKA-ELLGVDPALIEMHGAVS------EPVAQAMAA---------
GAFQRFGAD----------------------------------TAVAITGI--AGPGGGT
EQKPVGT---------------VCFC------------VLVGDG---------RNVTRTL
RLPGNR-------SDIRERSTTVAMHLLRRALS---------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------E
>gi|127511132|ref|YP_001092329.1|	   424 residues, 50 /line  competence/damage-inducible protein CinA [Shewanella loihica PV-4]
----------------MKIEMICTGEEVLSGQIVDTNAAW-AANALMDHGIEMQQRI---
-----TVGDRLDDLVEVFR-QRSEHADV--------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------I
LVNGGLGPTSDDMSSEAMAIAKGE------------------------------PLVECT
LW---RERIQEWFTRNGR--------HMPESNLK---------------QAML-PASAIM
VDNPVGTACGFRVK-LNRAWLFFTPGVPFEFKKMVTEQF-IPFVE------------QIA
DSHIE----------------------------------------VEVQKLLTIGQGESA
LADKLEGMP-LPDG-MTLGYRSFMPYIEIKLFARG--EAAIGEL-DRVKAEVLTRLGDAV
VGHNVASLAQVIHNGLLASGK-RLSIAESCTGGMIANNLVAFAGSSNYLDQG------LV
T----------YSNESKVR-VLGVKPATLDDHGAVS------IATVEEMAK---------
GARGLLDSD----------------------------------YALATSGI--AGPDGGS
EAKPVGT---------------VAIA-------------LATRQ---------GVYSQML
KFPARSR------ELVRQLSTAVALDMLRRELQ---------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------ESPVLVDYS----SYPRF------AR
>gi|111115615|ref|YP_710233.1|	   193 residues, 50 /line  hypothetical protein BAPKO_0832 [Borrelia afzelii PKo]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MRIA
ILGGTYNPVHIG--HIFLAKEIEY-------------------------LLNI-------
----------------------------------DKIIFI--P-TCNPTHKLI-GEG---
--------------------------VSVKNRIDM--------LK------------LAL
K------N---------------------------------ENKM-FIDDCDII------
------------------------------------------------------------
-----------------NGGI-TYTIDTIS-----------------CVKKK--------
----------Y-KNDKL-FLVIGDDLFQNFDS-----W-KDPQSIA--------------
----SS------------VDLVVAHRIY--------KE----------------------
-----------RLKS---SFKHIYID--------------NKII---------PISSSEI
RNRIANG-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------FPVSYLLPFGVLKYIKDN------N----LYVKKVN-----V
>gi|121524270|ref|ZP_01657206.1|	   201 residues, 50 /line  Nicotinate-nucleotide adenylyltransferase [Parvibaculum lavamentivorans DS-1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MA-
---------------------------------------------R---RELLTPGLKVG
LLGGSFNPAHEG--HLHVTRMCLR-------------------------ALGL-----DR
VW---W---------------------LVSPQNP---------------LKSD-AGM---
--------------------------ASFDRRLAS--------AE-------------KM
A------R---------------------------------DPRI-CVSDIEAR------
------------------------------------------------------------
-----------------L-GT-RYTVDTLA-----------------ALTSR--------
----------F-PQIRF-VWLMGADNLIQLPH-----W-ARWRDIV--------------
----QT------------VPIAVYPRPG--------FTL--KARLSPAATALRDVT---L
DATDA---ALLPLLT---APALAFLD--------------GPES---------SQSATSI
RERG--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------GWSL--------R
>gi|146346398|gb|EDK32934.1|	   203 residues, 50 /line  nadD [Clostridium kluyveri DSM 555]
---------------------M--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------VKKA
IFGGTFDPIHNG--HIHIAYEAIY-------------------------RLGL-------
----------------------------------DEIVFM--P-TGNPPHKAK-KSI---
--------------------------TDAFLRYEM--------VK------------VAI
R------S---------------------------------ESKF-TVSNYEVN------
------------------------------------------------------------
-----------------KTTL-SYTYSTLE-----------------HFNKL--------
----------E-SKTEW-YFLTGADCLMDI-----EKW-SRVDSIF--------------
----RL------------CKFIVFNRP-----------G--F-PAFTSE---SIED----
---QK---KKIEDKY---STNIIYLD--------------APLF---------DISSTVI
RNSVKEG-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------KNVNYFLPESVCNIIKQL------N----LYK----------
>gi|31544621|ref|NP_853199.1|	   366 residues, 50 /line  hypothetical protein MGA_0052 [Mycoplasma gallisepticum R]
-------------------MTM--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------KKII
IFGGSFNPIHNG--HVNIATKALE-------------------------QIKA-------
----------------------------------DRIYFV--P-TYKSTFKQA-FNI---
--------------------------SDIHRK-KM--------IQ------------NII
K------L---------------------------------NDRF-HFNWYELN------
------------------------------------------------------------
-----------------IQNE--KSYLTVK-----------------YFKKK--------
----------F-ANAQI-YFLIGSDNLEKF-----HLW-DEAEMMA--------------
----KDCQML----------------Y-----------Y--L-RDNQFSDHENIKK----
-------------------FNFLKID--------------GDNY---------QISSTKI
RNGTQVI---------GCVSDKNLAYINEHGLYINDRLKHFLRSDERFEHCLRVGQLARK
LAQYNYPNLAQKAYIAGCYHDLAKELDEKTMLSYRDQFDPKLFPEPYKKDLNYRVLHGYV
GAWILEHQFGYDDRELINSIYYHTIINDDPTPLDKIVYLADKLEPDRVKQEINRYFKINK
AKALA---FKNIHQAFKLTHDEIRKYL------QLSQKQES----------
>gi|67484066|ref|XP_657253.1|	   331 residues, 50 /line  conserved hypothetical protein [Entamoeba histolytica HM-1:IMSS]
------------------MNYINAS-------ICVDCSINLLH-----------------
-----VLSHIPSIIIPVKI-ENIQVKD-VCLEASRGLVP----L-LSYPSNTTYIAVCIS
SNAI------A--------IRDPIRLLYAEGSTVLNQLDILLTTFQKLPETPTG------
-----------NIALASLQIHYINYVDSFFK-NNNGVFCIELNG----------------
-------------------------------------------------SITHSIPQCPI
VYCGTFNPFHKA--HKKIIEYMSM-------------------------RFNH-------
----------------------------------RPIILD--I-SQRSEDKSV-TSL---
--------------------------TNVFIRASQ--------VA------------GKY
K------V---------------------------------NISN-TSLYIDKC------
------------------------------------------------------------
-----------------KTYP--GGTFVV-------------------------------
----------------G-LDTAVRILNKRY-----YQN-SEINLKK--------------
----AMQVIA-----SMGCNFIVVGRK-----------D--D-ITNRFLEFDSVKS----
---TL---PAKEYHY---LFISLNEK--------------EFRY---------DLSSTYL
RANGII------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------I------NKNILPKL----------
>gi|146418984|ref|XP_001485457.1|	   273 residues, 50 /line  hypothetical protein PGUG_03186 [Pichia guilliermondii ATCC 6260]
------------------MSQLSAK-------SLQKTVQD--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FL-ASGSHLRIIYNPSLD-------------
-------------------------------------------------ALANSNTRRIC
VLDSSFNPPHLG--HYALIKESLS-------------------------YKNQFPKDNQA
VL---L---------------------LFSVKNADKVTAA--P-AALE------HRL---
--------------------------AMMCLMADY--------VQ------------KKM
Q--VNVSV---------------------------------GITD-HAKFVDK-------
------------------------------------------------------------
------------------------SSTILR-----------------YLKEQ--------
----------N-LLAKL-TFLVGFDTLLRILNPNYYLP-DKI--LA--------------
----ALSEFM-----GSTDLFCLTRND---------EKL--S-VADQSLYVQTLRS---G
GHEDL---PSIWSQS---ISLHTGEI--------------DIVG---------AMSSSKI
RKEVADG-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------HKEWHNEVIPEIHQYIVEQ------S----LYKKL-------E
>gi|46109458|ref|XP_381787.1|	   263 residues, 50 /line  hypothetical protein FG01611.1 [Gibberella zeae PH-1]
------------------MPSIDPKTL--VS-TFSRALSS--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FQ-SSPDAFRVLCTLPHTS---NV----PA-
---------------------------------------------P---RRPGRPVQHLV
VLDSSFNPPTLA--HANMARTALG-------------------------LEGH-----QR
LM---L---------------------LLSVNNADKA-PK--P-ASFP------IRL---
--------------------------SMMEAMGRE--------LL------------DK-
G--IEIDV---------------------------------AVTT-MPFFHDKA------
------------------------------------------------------------
-----------------KAIT-----ESGF-----------------YVAET--------
----------G-EQPTQ-TFLAGFDTIVRIFNPKYYNE--GI--RS--------------
----ALRPFF-----ESC-KVRVTTRPD--------ETW--GGVEEQRAWLTRER----V
KDVGG---DEAWVER---VEMVEGRE--------------GDED---------CLVHVAV
----------------------TWSWLRNEAIL---------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------VCFVYCR----------
>gi|91202924|emb|CAJ72563.1|	   205 residues, 50 /line  similar to nicotinic acid mononucleotide adenylyltransferase, NAD(P) requiring [Candidatus Kuenenia stuttgartiensis]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------MMNIG
IFGGSFNPIHIG--HLIVAEEVFQ-------------------------QRKL-------
----------------------------------SKILFI--P-TGISPHKES-GGL---
--------------------------IDSFHRYEM--------VK------------QAI
G------D---------------------------------NEHF-EVSDIEIK------
------------------------------------------------------------
-----------------RPGK-SYTIDTIK-----------------ILRET--------
----------YGPGSNL-FLILGTDMINEI-----NTW-KDIEELS--------------
----CM------------CHFIVVNRFP--------ITL--NGEIIKK------------
---SA---ISGEKKA---EIEKLMVQ--------------IPSL---------DISSTEI
RKKLSKG-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------LSIKYLVPERVENYIRKH------S----LYAK--------R
>gi|145617557|ref|ZP_01773622.1|	   216 residues, 50 /line  nicotinate (nicotinamide) nucleotide adenylyltransferase [Geobacter bemidjiensis Bem]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MRLG
ILGGTFNPIHNA--HLRIAEEARD-------------------------LYQL-------
----------------------------------DRVVFI--P-AATPPHKPL-VGE---
--------------------------LSFASRLEM--------VR------------LAV
A------D---------------------------------NPGF-MVSDMEGV------
------------------------------------------------------------
-----------------RGGR-SYSIDTLR-----------------ELKAR--------
----------Y-PDDDL-FFIVGADSFNDISTWRE------YEAIF--------------
----EL------------CNVISVQRPG--------STI--TSLAEALPVAIAGEF---C
YDPAA---KRLNHCS---GHAVYALD--------------GVLL---------DISSSHI
RLSVQGG-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------RSIRYLLPDAVEHYIKEQ------R----LYVDA-------R
>gi|91773440|ref|YP_566132.1|	   386 residues, 50 /line  Cytidyltransferase-related [Methanococcoides burtonii DSM 6242]
-------------------MHIHDSPCQLVL-AATGGGAGAID-----------------
-----QLLRYGGGSATVLE-ALVPYSS-KALDELIGKKP----EKYVSPVTVRAMAMAAY
RRALSLAGNDD--------GVAEKRLMGVAASCKLSVGDDEREGREHKIFVAIQSFDKTL
VRTLILRKE--RSREEEEYIATCMVVDSIAKECSWTGNLLLEELLCGD---EV----VEE
REATASKEVAQMLALPD------------NIMNSLDLVSDVVQFDL---GGENVTEKPEV
IFSGSFDPCHKN--HIQMAEQAFN-------------------------KLG------KK
VH---F---------------------EISLTNV---------------DKPS-IDL---
--------------------------ISLQERLDS--------LR------------KYK
DYVFFGGV---------------------------------LLTV-APLFIQKV------
------------------------------------------------------------
-----------------NL-----------------------------------------
-------------FEKA-TFIVGADTVNRLFKTRYYRN-VE-DMRD--------------
----MLQYFR-----NRNTHFLVFQRKG--------VD----------------------
--LEL---EPDILDL---CEVVPLDD--------------YLDN---------GTSSTSI
RNVVQK------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------
>gi|20091254|ref|NP_617329.1|	   412 residues, 50 /line  hypothetical protein MA2423 [Methanosarcina acetivorans C2A]
MMVDNLAADKYSVP-VESIFQIHESPCKIVL-AITGGGAEILG-----------------
-----ELLRHGSGSATVLD-AVVPYSM-EAMDRFLGRKP----EKYCSEKTARLMAMVAY
QRALDLSKGEE--------SAAHD-VVGIGATCKLKAAN-ERKGRKHVVHVAIQAACKTG
VITLELAAD--RTREKEEKIAAFLIFNVLARHSGVPEVDLPGRIGTGDERKEE----ITE
KYESVSEPVGNLLKQKI------------CSQKGPDKTPDMARIDLNEGKSSAEPDKVRL
VFPGSFDPCHRN--HVFMAKLASE-------------------------KHG------EP
VH---F---------------------EISLTNV---------------DKPP-IDF---
--------------------------ISLNQRLDS--------LR------------KYR
DEAFVGGV---------------------------------CLTN-APLFLQKA------
------------------------------------------------------------
-----------------DL-----------------------------------------
-------------FPNS-TFIIGADTFNRLFDAKYYGG-KV-DISA--------------
----ILRHFR-----EKNIRFMVFQRKS--------VE----------------------
--MSV---NPEVLKF---CEIVPMDE--------------YEDD---------GISSTEI
RRKQEEN-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------KG---------------------------------------N
>gi|37523585|ref|NP_926962.1|	   206 residues, 50 /line  hypothetical protein glr4016 [Gloeobacter violaceus PCC 7421]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------MGERLG
IFGGTFNPVHRG--HLAMARAARD-------------------------RCGL-------
----------------------------------DQILWV--P-AAQPPHKPL-AGG---
--------------------------ASIGDRVEM--------VR------------LAI
A------G---------------------------------EAGM-ALSLVDAR------
------------------------------------------------------------
-----------------RPGP-SYAIDTLR-----------------LLEEQ--------
----------Y-PQAQW-HWLLGQDGLADLPG-----W-YRAAELI--------------
----PR------------CRWIVVPRPG--------SGA--DPKQAM-------------
--------ADLTERF---GAVFVPLS--------------DFEC---------DISSTRV
REQLAAG-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------RAGWEALLPEQVVSYIHKR------G----LYDVPAG-----A
>gi|116624935|ref|YP_827091.1|	   209 residues, 50 /line  cytidylyltransferase [Solibacter usitatus Ellin6076]
------------------------------MEFFR-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------RAAGRPTRLA
IFPGSFNPVTVA--HVALAEAALNVA--------------------------------DE
VV---F---------------------VLPRVFP---------------HKLY-EG----
--------------------------AKFAERAEI--------LC------------LAL
N------D---------------------------------RANF-SIAASEG-------
------------------------------------------------------------
----------------------GLFAEIAE-----------------ECRHA--------
----------Y-GDIQL-SFLCGRDAAERIANWDYG------EP---------------G
AFPAML----------RRFDFLVAARSG--------RYLPNEAH----------------
------------------KESFTALD-----------VP-AGLD---------HVSATEI
RARIARGE-----HWEHLVPPAVQQRVREIYRQ---------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------ANPTVPEGS---------------G
>gi|118045532|ref|ZP_01514192.1|	   209 residues, 50 /line  hypothetical protein CaggDRAFT_2671 [Chloroflexus aggregans DSM 9485]
--------------------MIHAA-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------ELADILN--------GRVGSLTIAPDGTLRIDD---------------PPPGA
IFPGSFNPLHEG--HIGLQRAVVV-------------------------MTGQ-----P-
VH---F---------------------ELTIRNA---------------DKGE-LSL---
--------------------------AEIE------------------------------
------------------------------------------------------------
--RRVAQFRGRY------------------------------------------------
---------------------YVILAAAPL-----------------FVQKARLYPGR--
------------------AFVLGYDTALRLVSPTYY------GSYE--------------
AMQAAFAAIA-----AANCRFFVAGRLI--------D--GRFCTLADLNLP---------
----------IGYE---KLFIPVPE--------------HLFRR---------DISSTEL
RSREMSDTP---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------NTT---NR
>gi|118061737|ref|ZP_01530090.1|	   378 residues, 50 /line  expressed protein [Roseiflexus castenholzii DSM 13941]
---------MNLIP-TETIAAIHDTPHRLVFEFAGAGSLA-LY-----------------
-----WLHSVPGSSRTVLE-ATDRYAA-TSLTDLIGKTP----EKFVSADTARIMAEMAY
RRAMRLTDGA-------------AACLGVACTAAIATD-RAKRG-AHGCSIAVYDGTTMR
AFNLTLAKGA-RDRAGEEQVISLLIIRAIASACGVAAPDLALEPPETL--------EVDE
E--TRPDPLTLLVQ--------GDVEDVFIDIDGHAHLKG---------------TPPVA
LLSGSFNPLHAG--HEQLAQAAAA-------------------------FLRV-----PV
VF-------------------------ELPILNA---------------DKPP-LGY---
--------------------------AELE------------------------------
------------------------------------------------------------
--RRLEQFRGRY------------------------------------------------
---------------------PVVLSRAPL-----------------FVQKANLFPGC--
------------------TFVIGYDTAIRIIDPRYY------DGEA--------------
GRNAAFAAIA-----AHGCTFLVAGRIK--------D--GVFRTLADIDLP---------
----------ASLR---PLFRELPE--------------RIFRV---------DLSSSAI
RNAYG-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------T
>gi|145354257|ref|XP_001421407.1|	   435 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
---------MEPGI-RAIVETIHASKVRAVLHVTGGGARA-LG-----------------
-----WLTSVPRCSNTLLD-ARVPYAR-ESALETLGRATDDDVESYCSREVAEALASAAY
ARAVRHGS---SRATASAS--DARATTGLGATCALTTEDVVKRG-DHRCFVAAKTLGRMT
TYEMRLEKTSGRSRFDEEGCASRLVLRALYEEARRSVDDADADAGVDLVREVLSEREFDE
VSVTTMEDSAYANASDARAVVERWLAEDDSSTSGATTAAPMILEFTGGVLTAVGATRANV
VLSGSFNPLHDG--HRDLLAAATATKPPG-----------------------------AL
GA---Y---------------------EIGVTNA---------------DKGT-LSI---
--------------------------DEIM------------------------------
------------------------------------------------------------
--RRLEQFSTPG------------------------------------------------
--------------------TVCLLTKTPL-----------------FVDKTRAAPGA--
------------------AFVVGADTAARLLDPKYA------GSDA--------------
ALDESLNEIR-----ANACDFLVAGRVD--------RVSRAFVPAADVLAA---------
----------AAARRAADLFAAL----------------PSFRV---------DVSSTEI
RNAARDSGR---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------D
>gi|145536882|ref|XP_001454163.1|	   398 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
------------MS-YILVKQLNDSQL-IVLYTAGAGAQA-LC-----------------
-----HFTLHPGSSKYAME-SSSFYAK-GSLELLLNRNI----EKFVTEQVAEDMALKAL
IRSHEILRQEYITDKYDFCSIRFNTTLGIGVTAAIRSV-NERQG-RHHAFICLNFGIAKY
TYYLDLVKGV-RTREEEDQFISDILFKLIIKHSSQHQQQIKEQEEEVL-----DKIQILE
NAKSMNLNLIKSLQNQT-----GLLNSILITANQYQLNPI---------------VQDAI
ILSGSFNPIHFG--HIELAKMSQQ-------------------------LMGL-----PN
VY---F---------------------ELSIKNA---------------DKQD-ITI---
--------------------------QDVEKRIEL-------------------------
------------------------------------------------------------
-------MKKQNL-----------------------------------------------
---------------------NIILSNKAF-----------------FKDKNLFLKNG--
------------------AFAIGVDTYKRVVDVKYY------NNSIQ-------------
ERDLSLLLFL-----QNNNKIIVAPRYN--------ETTQKLETLNDYEIP---------
----------KILEK-----NVIELK--------------EFRN---------DISSTKI
RQSEG-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------N
>gi|16127661|ref|NP_422225.1|	   216 residues, 50 /line  nicotinic acid mononucleotide adenyltransferase [Caulobacter crescentus CB15]
--------------------MWFAGPARLVPEAGRPNAQR-LGFHL--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------EPGMRVG
LFGGSFNPAHEG--HAHVAETAMR-------------------------RLEL-----DR
VI---W---------------------LVSPQNP---------------LKPT-HET---
--------------------------RPVAERMAN--------AR------------RWA
R----------------------------------------GSGM-IVSDAET-------
------------------------------------------------------------
-----------------RLGS-QYTIDTLR-----------------VLRAR--------
----------Y-PGVKF-VWVMGADSLATFHRWRGW------TQIM--------------
----------------REVPVAVISRPW--------IAL--KARTSPAAR------RFAF
ARWPASAAARLPDAK---SPAWVYLT--------------GPLN---------FASSTAM
RARQK-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------G
>gi|34763712|ref|ZP_00144634.1|	   194 residues, 50 /line  NICOTINATE-NUCLEOTIDE ADENYLYLTRANSFERASE; NICOTINAMIDE-NUCLEOTIDE ADENYLYLTRANSFERASE [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MKIA
IYGGSFNPMHIG--HEKIVDYVLK-------------------------NLDM-----DK
II---I---------------------IPVGIPS---------------HREN--NL---
--------------------------EQPDTRLKI--------CR------------DIF
K------N---------------------------------NKKV-EISDIEIK------
------------------------------------------------------------
-----------------SKGK-SYTYDTLL-----------------KLIEI--------
----------YGKDNEF-FEIIGEDSLKNLKTWRNY------KELL--------------
----------------NLCKFIVFRRKD--------DKN--IEID---------------
----------NEFLN---NKNIIILE--------------NEYY---------NISSTEI
RNKVKNDE-----DITGLVNEKVKNLIKKEYKE---------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------D
>gi|39975719|ref|XP_369250.1|	   334 residues, 50 /line  hypothetical protein MGG_06214 [Magnaporthe grisea 70-15]
-----------------------MSPNVKVLDFFKEGLEN-F------RLSQDQLEI---
-----LCEAP---------------------------------RHDAGLPLTQDV-----
--------------ICNTTISTNRKT----------------------------------
------------------------------------------------------------
---------------------------------------------DALERSKPRLPRRII
VMDASFNPPTSA--HMQMATSAIRSAGDRR----------------------N-----TR
LL---L---------------------LLAVSNA---------------DKAP--KP---
--------------------------ASFEQRLAM--------MN------------ALA
Q------DVYEEISY-----------DDEAGAA------------APESDDNGH------
------------------------------------------------------------
-----------------RFGIDLALTTLPY-----------------FHDKSAALAAVVE
TAFEPPPTGR--APVEQ-VFLIGYDTLIRLFNPKYY------SRTEN--------GETVN
GIREALSPLF------GRARARLTLRAD--------ADW--GGREEQLAYLENVRHGDAL
EQAGG---L---KEW---ASRIDVAE-----------TG-DAHG---------LVSSTSA
REAAARGDW---VRLRELVPPRVAAWVQDERLY---------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------QES-------E
>gi|46199770|ref|YP_005437.1|	   394 residues, 50 /line  competence-damage protein cinA [Thermus thermophilus HB27]
---------------MERAEILGVGTELLYGETLDTNTAE-IARSLKPYALKVERTL---
-----RVADEVAPLAREVE-EAFARARL--------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------V
VLSGGLGPTPDDVTREAVALALGE-------------------------PLEL-----DE
AV---LGEIEAFFRARGR--------AMPEANRK---------------QAMR-IPSATW
LKNPRGTAPGWWV-RKGGKDLVLLPGPPPEWRPMWQE-V-LPCL----------------
---------------GLPRRPY------------------------AERVLKTWGIGESE
IVERLGPLFVRGEE-VEVGTYPKVHGVEVVVRGR-------EDRVAELAERIKKKLLKEV
WGEGEMTLAEAVKRRMEREGA-TLSTMESLTGGLLGAEITRVPGASRFYLGG------VV
S---------Y-SVGAKARFGVPQDLLSRTVS----------AETARAMAE---------
AARSLFGST----------------------------------YALATTGV--AGPDPLE
G-EPP---GT------------VYVA-------------LAGPT---------G------
------------AEVRRYRFPGDRETVRLRSVY---------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------AALALL---VT
>gi|67937925|ref|ZP_00530455.1|	   198 residues, 50 /line  Cytidyltransferase-related:Probable nicotinate-nucleotide adenylyltransferase [Chlorobium phaeobacteroides BS1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MRLA
VFGGSFDPPHNG--HLALCLYARE-------------------------LLQV-----DR
LV-------------------------ISASNNP---------------LKDA--PQ---
--------------------------AADRDRVKM--------AE------------LLA
E------TINR------------------------------TGAFAEVSSWEAN------
------------------------------------------------------------
-----------------RGHP-VYTIDLME-----------------YLEEI--------
----------Y-STSDL-TLLIGEDNFLNFRQWKSW------EELI--------------
----------------RRYSIIVFGRKA--------DDG--ASDDSAI------------
----------SERLH---DQSFRHI---------------DLNL---------PLSSTEI
RKRLASGD-----DCSAEIPSPIWQYIVENQLY---------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------Q----------
>gi|70994636|ref|XP_752095.1|	   289 residues, 50 /line  cytidylyltransferase family protein [Aspergillus fumigatus Af293]
-----MASNSY----------------KALRSQYQAALKR-F------ITSSKNLEI---
-----LNSVPLNH-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------QQYQKQPSQAPDILY
VLDSSFNPPTLA--HLRIASSALLEK-----------------------PSVP-----SR
LL---L---------------------LLATQNA---------------DKPS--KP---
--------------------------ANFEDRLAM--------ME------------LFA
Q------DLLSHLGTI-SSSPADA----------------------GLQQIDI-------
------------------------------------------------------------
-----------------------GVTKKPY-----------------FVDKAAEIEQSGI
YPK----------ALEQ-VHLTGYDTLIRIFNPKYY------PP---------------E
HTLQRLGPFL------SQHRLRVTMRPG--------DEW--GSKEEQKAFLLHLA-QGGR
EHEGG---K---REW---AQRIQLVE-----------GKKPGDK---------PVSSTKA
REAIQTNSQ----DLDWLVPRSVREYILSQRLY---------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------AE---------
>gi|71657281|ref|XP_817158.1|	   425 residues, 50 /line  hypothetical protein [Trypanosoma cruzi strain CL Brener]
---------MAILP-HGFIEAIHASPLRCVLYVMGAGSSV-IA-----------------
-----QLTSVAGCSRTLLD-ARVPYAM-AAALQMLDDRP----PKMVSATVARQMAQHAY
HRAVEYSN-----------GDDDGTLVGIGSTSAVQTD-RIRHG-KDCAFVAAWSQRQVV
EFAMELPGH--LARAEQEEQVTLLLFKALAECAKVPFEISFVVEPKRL------------
SYILPDSPLRSLLQ--------GEIKFLVFNTYGELRADFVPYVAETSFAVKTENSWKAL
LFPGSFRPLHWG--HTELARAAVRAMATMKGKLNSKSTDISSPSWNVPDASNV-----R-
VT---Y---------------------EIAVDNA---------------DKGI-ID----
------------------------------------------------------------
------------------------------------------------SDVELK------
--KRVQQFL-Q-------------------------------------------------
-----------------RGAR-VAVTRARL-----------------FTEKALLFPGH--
------------------GFIVGIDTMKRILDPKYY------DNSRE-------------
AMLRAMQFIR-----EQGGYFVVAGRAS--------GGK--DAVWEDLTS----------
IEVP------AEVES---MLISIRK--------------EDFCV---------DVSSTML
RERSKST-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------C
>gi|85110717|ref|XP_963597.1|	   425 residues, 50 /line  hypothetical protein [Neurospora crassa OR74A]
-----MPHDDDMLE-RSQSLLRSATSRRHLTDFFSRALSA-FQSP---SDSAQNFQV---
-----VCTAPPAS-----------------------------------------------
-------S---SNASCSAAGAHEAQGKPLH------------------------------
-----------------------------------------------------------P
QSPAPIP--------------------------------------------PTKRPHTLI
VLDSSFNPPTLA--HLRMATSAVRDTIKKK-----------RRGEDAKDMSGL-----RL
LL---L---------------------LAVVN-A---------------DKAP--KP---
--------------------------AAFDQRLAM--------MW------------AFA
H------DVQRALRGEADKSPVEVSPASGPGPKPEKSHIHDSSQL-KAADEEQQ------
-KQGVPQVD-ISV-----------------------------------------------
--------------------D-IGLTSKPY-----------------FHEKSRVIAESEF
YKP-PQEEGEE-DTMEQ-VILVGFDTLIRIFNPKYY------GPATQVTAHAQDQSRKGS
PIQQALDPMF------KRAKLRVTLRTD--------DEW--GGKQEQVAYLESLLSEEGL
AKIGG---S---KEW---AERIELVE-----------GRRDGEE---------IVSSTYA
RKAAEREEW---GKLRRLVSPEVGKWIEGEKLNTL-------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------VLCQQGLVAARKDTGNISGGLQ------VA
>gi|87306561|ref|ZP_01088708.1|	   370 residues, 50 /line  hypothetical protein DSM3645_09517 [Blastopirellula marina DSM 3645]
------------------------------MAVAGGGSEA-IS-----------------
-----RLLQVPGASLTLLE-ATVPYSS-IALTDLLKRTP----EQYCSEATARAMAVSAF
LRARKLWQ---KAVESGLASGEQPPLMGVGCTASLKSH-RAKKG-PHRVHLAIQTPEATT
VANLVLTKEA-RTRDEEEKLTAELILDRLAAAAGLTETLRLSLLPGEQ---------IDE
TVYRAQPSWRELLQ--------GDIRACVGA---------------GET--VSPSENSGV
VMSGAFNPLHEG--HLEMAAVAEQ-------------------------ILGR-----P-
VE---Y---------------------EISIENV---------------EKPP-LDF---
--------------------------GEMA------------------------------
------------------------------------------------------------
--ERVDQFE---------------------------------------------------
-----------------PPQR-CWLTRAPT-----------------FVEKS--------
----------R-IFPET-TFVVGADTIVRIADLRYY------NDSEK-------------
KRDAAIREFN-----EQNCRFLVFPRQV--------KGE--FTTLEEIELP---------
----------TALRR---LSDGVSP--------------AMFRA---------DISSTEI
RRRISELG----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------
>gi|37522010|ref|NP_925387.1|	   426 residues, 50 /line  competence-damage inducible protein CinA homolog [Gloeobacter violaceus PCC 7421]
-------------M-APSAEILCIGTELLLGQIVNTNAQF-LAVELAKLGIPHHFQT---
-----VVGDNPGRIRLALD-IAIERAGIILTTGGLG------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------PTDDDLTHQ
TLAEHFEVPLVR--HPALLALIEE-------------------------RFRE-----RN
RP-------------------------MSPTNAK---------------QADL-PEGAQI
LPNPMGTAPGIVWEPKAGVAILTFPGVPAEMRAMWAETA-VPFLR------------LRG
G------G---------------------------------QEIF-HSRTLRHWGVSEST
LAEKVEEFL-RGVN-PTVAPYAGNGEVKLRITARAAGIAAAESLIAPVEASLRTIAGLDC
YGADEDTLASASAALLVRTGT-TLAVAESCTGGMLAEALTALPGASRYLRGA------VV
A---------Y-ANDLK-TSLLGVDEQRMIDHGAVS------EPVARAMAE---------
GVRNRLASD----------------------------------WGLALTGV--SGPGGGT
AQKPV---GL------------VHIA-------------LAGPG---------ETRAVEI
RLGAQRGR-----DWIRRVSTQSALDLLRREII---------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------NWEAFGIM-KE--------R
>gi|146296820|ref|YP_001180591.1|	   196 residues, 50 /line  nicotinate (nicotinamide) nucleotide adenylyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MKVA
IFGGTFNPIHIG--HLIMAQYVKN-------------------------FSEV-----DR
VI---F---------------------VPNGVPP---------------HKNV--DI---
--------------------------ALPEDRFEM--------VK------------LSI
E------D---------------------------------NPDF-EISDFEIK------
------------------------------------------------------------
-----------------NKEP-SWTINTLN-----------------YFATS--------
----------Y---EKV-YFILGSDNLFEIIKWYRA------EEIL--------------
----------------KKFPIIVLPRER--------NT---TLIRRQIEE----------
----------LGIQF---SAKMVLID--------------MPII---------DISSTEI
RRLIRENK-----SIRYMVHPKVEEYIIRKGLY---------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------KE---------
>gi|53687301|ref|ZP_00106950.2|	   208 residues, 50 /line  COG1057: Nicotinic acid mononucleotide adenylyltransferase [Nostoc punctiforme PCC 73102]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------MQQLA
IFGGTFDPIHWG--HLLIAETAMQ-------------------------EVSL-----EK
VI---W---------------------VPSLNPP---------------HKE----A---
--------------------------ALFEHRVEM--------LQ------------LAI
K------D---------------------------------NPAF-TVSLVEAN------
------------------------------------------------------------
-----------------RSGT-SYAINTLI-----------------DLSAC--------
----------Y-PNTHW-YWIVGLDTFQTLPRWYRG------HELA--------------
----------------QMCDWLIAPRLL--------GGE--TIT----------QSKLIC
KQVEQ---QMREQSY---TIYWQLLN--------------IPLV---------GVSSSLI
RKLCRERQ-----SIRYLVPEAVRSYITNNSFY---------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------SNK------SE
>gi|51246439|ref|YP_066323.1|	   216 residues, 50 /line  similar to nicotinate-nucleotide adenylyltransferase [Desulfotalea psychrophila LSv54]
------------------------------------------------------------
------------------------------------M-----------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------LWKKMKKIG
LFGGTFNPLHNG--HLQLAEFAAA-------------------------QCQL-----DQ
VV---F---------------------LPAASPP---------------HKKG-DEI---
--------------------------VPFSHRAEM--------IR------------LAC
S------R---------------------------------NKRF-SCNTIEQD------
------------------------------------------------------------
-----------------LARP-SYTVDTLQ-----------------ALKTS------PL
Y---------K-SEAQF-FFLIGVDAFIELKTWKAY------RDLL--------------
----------------SEINFILCPRKL--------FSR--TQTVLFLT-------ELGF
VQTPL---G-WEHSS---YLTLYELE--------------GAPD---------QVSSTEV
RRTFEKSG-----DLYQKLPPTVADYIMKHGLY---------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------
>gi|37524458|ref|NP_927802.1|	   208 residues, 50 /line  hypothetical protein plu0449 [Photorhabdus luminescens subsp. laumondii TTO1]
-------------------MNMPDKNERYLIDLINGKLNY-IHID---------------
------------------------------RNGDFNN-----------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------TNIDWKETL
ILSGSFNPLHKG--HEELKEIATA-------------------------MTKR-----K-
------------------------------------------------------------
---------------------------------PY--------YE------------LSI
K------N---------------------------------AVKL-TISTDEIF------
--ERIRQFK---------------------------------------------------
-----------------GKGD-IVLSDAKI-----------------FTEKS--------
----------H-IYQGA-IFVIGADLCQEINNPIYY------GGEE--------------
GLKKSLMTIK-----NNDCRFLVAGRFF--------NNK--YHTVDDLMN----------
----I---R-KEHRF---LFESIPE--------------NLFRL---------DISSTEI
RLMNKE------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------
>gi|118582013|ref|YP_903263.1|	   221 residues, 50 /line  nicotinate (nicotinamide) nucleotide adenylyltransferase [Pelobacter propionicus DSM 2379]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------MVSPVMKIG
LMGGTFNPIHMA--HLRIAEEARE-------------------------LCGL-----DR
VL---F---------------------IPVADPP---------------HKPL-AGE---
--------------------------VPFHQRCQM--------VR------------LAI
A------G---------------------------------NRAF-ELSEIEGQ------
------------------------------------------------------------
-----------------RPGK-SYSIDTIG-----------------TFREQ--------
----------H-PQAEL-YFIIGSDSFLELGLWRRY------ADIL--------------
----------------RSCNLIVVERPG--------RQV--NDPLSALPVD--IRGELRY
TPASR---S-LEHVG---GTRVHFFA--------------GCLL---------DISSSEI
RRLAATGR-----SITYLVPPQVEAYIKEQRIY---------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------SEC-------P
>gi|146273267|dbj|BAF59016.1|	   201 residues, 50 /line  nicotinic acid mononucleotide adenylyltransferase [Pelotomaculum thermopropionicum SI]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------MRRIG
IMGGTFDPIHYG--HLVAAEGARY-------------------------EFGL-----NR
VI---F---------------------IPAGRPP---------------HKPD-CNI---
--------------------------TDPSHRYKM--------TC------------LAV
A------T---------------------------------NPFF-QVSALEVE------
------------------------------------------------------------
-----------------RPGP-SYTIDTVQ-----------------EISRL--------
----------Y-PDAEV-FFITGSDAVMEILTWKNF------ERLL--------------
----------------SICFFIAAARPG--------YKL--NELWKRLVL----------
----------LPENL---KERIFCME--------------VPAL---------AISSTDI
RQRVSEGR-----PIKYLLPEPVEDYIQKNGLY---------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------R---------Q
>gi|15894544|ref|NP_347893.1|	   200 residues, 50 /line  nicotinic acid mononucleotide adenyltransferase [Clostridium acetobutylicum ATCC 824]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------MKKKA
IFGGTFNPIHNA--HLNIAAKSIE-------------------------KLQL-----DE
LI---F---------------------VPSGNPP---------------HKSE-KGI---
--------------------------APAELRYEM--------VK------------EAI
K------D---------------------------------NCKF-RIDDYEIK------
------------------------------------------------------------
-----------------KKGI-SYTYETLE-----------------HFSRS--------
----------Q-KDVDW-FFIAGLDSLMDLDKWRNV------NTIL--------------
----------------SLCKFIVFNRSG--------YNK--SQVLEQKEY----------
----------LEKKY---INNIVFLD--------------IKPI---------DISSTII
RQKIRENE-----YIGDLVPEKIYDIIKKNKLY---------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------V
>gi|47459111|ref|YP_015973.1|	   360 residues, 50 /line  hypothetical protein MMOB2760 [Mycoplasma mobile 163K]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------MNKIG
IFGGSFDPIHIA--HTFVAEESIK-------------------------ILNL-----DK
LF---F---------------------VPTFINP---------------DKIG-RKS---
--------------------------ASPEDRINM--------IN------------LVK
P------E-----------------------------------KS-EVSLFEIN------
------------------------------------------------------------
-----------------RKNI-SYSIDTLK-----------------YFKSK--------
----------Y-PNDQL-FFIIGSDNINKINKWEGI------DWIY--------------
----------------QNVQIVVFRREK--------LIN--KINIKKY------------
--------------------KAILLD--------------NKIL---------DYSSSNY
KK-----------GNTFLVDKKVQCYIGKNLLYGQDIAINNLEA-KRYKHSVATEVMATK
IAKKLNFDLKAAA-FSGLMHDITKNWDIEEHYKFLEEQNYPN----FNKVEKHKLHQISA
SIW-LKNIFLVENEQIINSIGCHTTLKNDLSLLDKIVFVADKICEGR------KYEGIQK
VRKLALENFDEAFKLVVKRTWDFNLEKNIPLSEEQINIY-RKW------SQ
>gi|15895057|ref|NP_348406.1|	   201 residues, 50 /line  Predicted nucleotidyltransferase [Clostridium acetobutylicum ATCC 824]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MHSNNIIL
VYGGAFNPPSAS--HITLAKQLLN-------------------------YTGA-----KK
LM---F---------------------VPVGNQY---------------KK---KEL---
--------------------------IPAYHRINM--------LQ------------IAC
E------C---------------------------------NNRL-EVNTTDVD------
------------------------------------------------------------
-----------------FKRR-LYTIETLE-----------------IIKKQ--------
----------N-SDKDI-YFIIGTDNLRDILNWKHW------QRLL--------------
----------------TEYKIIVMDRGE--------DTI--FKVFKDIPI----------
----------L-KKY---KANLIQIP-------------GLLVN---------NISSTLI
RNNIRQDK-----TIEHLTIKKIIKYIKENNLY---------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------K
>gi|111066068|gb|EAT87188.1|	   306 residues, 50 /line  hypothetical protein SNOG_04797 [Phaeosphaeria nodorum SN15]
-------MASRIAAIRAI------------LPDLESALHS--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FT-ASPSKFRVVRTVN---------------
--------------------------------------------------ATNTQPRTLY
ILDSSFNPPSIA--HLTLATSALKQ-------------------------HAPSEAAPYR
LL---L---------------------LFSTHNADK-APS--P-ASFV------QRL---
--------------------------ALMTVFAED--------LSRHLKSEESTQKEHVA
D--MSIDI---------------------------------GLTK-EPYYSD--------
------------------------------------------------------------
--------------------------------------------------KSAAIKDTT-
---PPFY-S---SNPIH-VHLVGYDTLIRFCNPKYYPKYDPP------------------
--LSALRPFF-----DAGHKLRVTQRPADPSDQSSSEFG---TVQEQEKYVQRLRDGEE-
EKNGF---LPAWGNN---IDMAPAE----------------RGV---------GISSTRV
RNAAKDAKW---DVVSELCTEGVAAWIKDQ------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------S----LYSEDASGKKMMA
>gi|146450958|gb|EDK45214.1|	   293 residues, 50 /line  conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239]
------------------------------MSQFSKALRE--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FV-ASKADFSIIYSTLASSNSS---------
----------------------------------------GGNTSTQQAAFVTPHTQRVC
VLDSSFNPPHLG--HSALVEELLRSN------------------------YDHIPNENKS
LL---L---------------------LLSVKNADK-ETDHLPLEVFE------QRL---
--------------------------DMIHLMAND--------LS------------KRF
P--INISI---------------------------------GLTN-HAKFVD--------
------------------------------------------------------------
--------------------------------------------------KSLSIISYIE
EKFPDIV-T---PDFKL-TFLIGFDTLVRILDPKYYLP-DKF------------------
--SQSLENFM-----KKTDLFCLTRHD---------AVK---SLTQQEGYVKEISSGKH-
E-D-I---PSHWSNN---IFMLPSLN--------------EEIA---------NLSSSSI
RKEILSQGH-GDSKWRAHVILEVAKYIDEH------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------D----IYLSTTS------
>gi|50285139|ref|XP_444998.1|	   275 residues, 50 /line  unnamed protein product [Candida glabrata]
-------------------------------MDYYQQYTE--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FV-AKNGQFCLFDGSLGV-------------
--------------------------------------------------KPINSGTKVL
VLDSSYNPPHLA--HFTLVKNAIEF-------------------------YGHRGFSNFH
VL---L---------------------LLATNNADK-RPK--P-ATFD------KRM---
--------------------------AMMKRFADF--------ISI--------QNWNGM
Q--VGVSC---------------------------------ALTT-HGKFVD--------
------------------------------------------------------------
--------------------------------------------------KLVDISKLIN
FGI---------EMPVI-TFLVGFDTLIRIFNPVYYEP-VSV------------------
--AEALRSFM-----ESVEFCCLRRED---------GKY---TLDFQEDYINKIINGEE-
EPQ-I---PSNWGEK---IHILSF-N--------------ESVK---------NISSSMV
RDVVNNKGS-DAIDLKDSIPMVIVEYIKQNP-----------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------S----LFKNDIE-----E
>gi|19115395|ref|NP_594483.1|	   249 residues, 50 /line  hypothetical protein SPAC694.03 [Schizosaccharomyces pombe 972h-]
---------------------------MDQAKKYANLLDS--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FR-SSTEDILLLER-----------------
---------------------------------------------------LEVSDKPIY
VLDSSFNPPHFA--HLGMCLSIPK---------------------------------GSQ
LL---L---------------------LLSITNADK-PVA--P-AAFN------ERI---
--------------------------LMMEKLKTL--------IH---------------
N--CTVSV---------------------------------AICK-HALFVD--------
------------------------------------------------------------
--------------------------------------------------KCRSISNKL-
------------GPREQ-VYLVGFDTLIRILDCKYYKE-KAM------------------
--QQVLQPFF-----SCSQILCFSREV---------DGT---TTDDQAQYLEKIKKSLL-
P-N-I---PSQWSEK---IKLTKLKG--------------NVGF---------GVSSTRA
RQAIISGDE---ETQRKIIPQEILNVIKVI------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------Q----PYRHR--------
>gi|45199240|ref|NP_986269.1|	   257 residues, 50 /line  AFR721Wp [Ashbya gossypii ATCC 10895]
---------------------------MQS-TRHFQLLEE--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------SK-LSGTHFEIVYGK----------------
-------------------------------------------------RFLDAPERRLL
VLDSSFNPPHFG--HCELIERAVEH----------------------------YKSEQLH
VL---L---------------------LLSVNNADK-AAK--P-ATFD------KRL---
--------------------------YMMSILAEL--------LS------------KS-
---IDSSV---------------------------------GLTT-HARFIE--------
------------------------------------------------------------
--------------------------------------------------KTGAIRKH--
-GF---------HVGPI-TYLMGFDTLIRFFDPRYYQP-STL------------------
--IEALSEFM-----QHTELFCLTRED---------GA----GPENQATYCATLATGGF-
EPH-M---PRNWASH---IFI-DSRA--------------GKYY---------GLSSTKV
RNLIAQP-----RALSDLVPKEILDYICIA------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------G----GPKIFTE------
>gi|50545425|ref|XP_500250.1|	   252 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
------------MSLYTLVRAAATHSRPPAGTNFKAEIDD--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FM-RGDERVRLLGD-----------------
---------------------------------------------------MPRKGSRVV
VLDSSFNPPHYA--HLELAMLGMTH------------------------------TKDNC
IL---L---------------------LLSITNADK-KPA--P-AAFQ------QRL---
--------------------------EMMELFKRS--------I----------------
D--AEVVL---------------------------------GLTK-EPYFVD--------
------------------------------------------------------------
--------------------------------------------------KYKVIKRLLA
SHG---------LTPHL-HFPMGLDTLVRLVDQKYYKE--PV------------------
--SEALKGFF-----QDCHVHVLTRDD---------IHF---NMK---------------
--E-L---PEQWQRH---IHMSKH-S--------------SKTD---------GVSSSNV
RALVKSHKR--HHEFERLVPPQILAYIVEH------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------G----LYK----------
>gi|50422815|ref|XP_459985.1|	   267 residues, 50 /line  hypothetical protein DEHA0E16412g [Debaryomyces hansenii CBS767]
---------------------------------MSKLLTE--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FI-SSRSAFSIIYSTPS--------------
-------------------------------------------------NVLTKRAKRIC
VLDSSFNPPHLG--HYSLVRESLIYN------------------------YNEPPSDGKI
VL---L---------------------LLSVNNADKLTPQ--P-ASFD------HRI---
--------------------------EMMFKLADH--------IN------------ESL
R--VDVKV---------------------------------GLTN-HAKFVD--------
------------------------------------------------------------
--------------------------------------------------KSEAICSYMK
NYE-QLS-M---SNIRL-SFLVGYDTLIRILDPKYYLP-DNL------------------
--ETALAGFF-----ETSDLFCLTRSD---------GSI---SLEKQFDYLDSISKGNI-
Q-Y-I---PKHWSSN---IYLTHNES--------------LELS---------KISSSSI
RSNILNDN----KEWVYKVTPDIKNYIVNE------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------H----IYKD---------
>gi|68467229|ref|XP_722276.1|	   298 residues, 50 /line  hypothetical protein CaO19_12418 [Candida albicans SC5314]
----------------------------MSKGRFLKPLQE--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FL-TSKSDFSIIYNTSTTGS-----------
-----------------------------------------------TSSFINPTTQRVC
ILDSSFNPPHLG--HYALIEESLTKN------------------------YDNIPITNKV
VL---L---------------------LLSVKNADKLHPK--P-ESFD------KRL---
--------------------------DMMYLMAND--------LS------------KKY
P--VNIAI---------------------------------GLTN-HAKFVD--------
------------------------------------------------------------
--------------------------------------------------KSLSVLNYIK
ETQNHHQER---NLIKL-TFLVGFDTLIRIFDPKYYLP-DKL------------------
--SNSLENFM-----KNTDLFCLTRLD---------NSF---SQLEQSKYIDDIKRGDH-
E-E-I---PSHWSDN---IYLLPPKKEIEINQRGGEINQEIDVA---------TISSSSI
RKQIEIGDHPDGKTWKSQVLPDIANYIIKE------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------D----LYKQS--------
>gi|6319802|ref|NP_009883.1|	   258 residues, 50 /line  Putative protein of unknown function [Saccharomyces cerevisiae]
---------------------------------MKKTFEQ--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------FR-KSNLLFQVLKGPQ---------------
----------------------------------------------------HLECQKLF
VLDSSFNPPHLA--HFQLLSQTIKN-------------------------FKL-KDTRSH
VL---L---------------------LLAVNNADK-LPK--P-ASFP------TRL---
--------------------------EMMCLFADY--------LQEKL-----------P
Q--SVVSV---------------------------------GLTV-FSKFID--------
------------------------------------------------------------
--------------------------------------------------KDKILHEQFV
-------KG---CSADI-GYLVGFDTIARIFDEKYYHP-LKI------------------
--SDVMESFM-----SGSQLYCLARGD---------CHL---SAESQLRYASDILEGKF-
EPV-I---PREWGAR---IHVMQNDY--------------PALR---------NVSSSEI
RNKLKNGQV---ESLKDELPLCIYDYLINN------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------K----TIFD---------


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.