FANDOM


>gi|18379168|ref|NP_565256.1|	   720 residues, 50 /line  octicosapeptide/Phox/Bem1p (PB1) domain-containing protein [Arabidopsis thaliana]
----------MEPPPSSLSSTAVASTSISAATAPVPPPLPPHVTSSYP------------
------------------------------------------------------------
------------ESLDSSPRSRTTDGWD--------------------------------
----------------------DLPAPSGGGGGGGGSAVSSKLRFMCSY--GGHILPRPH
D-------------KS--LCYMGGDTRIVVVDRN------------SSLPS---------
-------LIAR--------------------LSNTLL---DGRSFTLKY-----------
------------QLPSEDLDSLISVTTDEDLDNM-----------------------IEE
YDRTISAS--------N---STKPSRLRLFLFTSKP-------EATQSMGQILESSAKSD
DWFLNA-----LNSA----------------------------GLLNR---GFSDSDTNV
NRLLGLDDALALRSNSGDNNNRDGDDGSVKSAKQQQPPP-PQQQEQQQGGQDVNCLPDSP
MLDT-SSSFGSTSS--SP---------------SL-----ANLPPIRVHVEEP-GGVRTL
P------DQRNLGIEEQFARFNVGNKHQLHDDGFAAISSP-------PPMPVTIALPAAP
VTAATVSNEFQ-ARVYSDDERSDHGVQ-AGYRKPPTPRS------------QPQ------
-NLPPQQAHQL--KSNSGGGHELPSPNSVSSDSSMSNPMFHQRPSVYQEPIAQIPSGSTV
VTGMINPSDPSTLLSQHQNQDPAYILH---PQFEQQSAQSQPQQQFIH--TAAPPQYIHH
HPSSGLPVPTYIQ--VYPSQQPQQSFHQHAGRLDQQPYPVY---YVTAPVPPRPYSMPVP
QSPSVSDAAGSIPSNHPNSTMM---------------------PPPPNNHMRSVSSGKPE
MGQAGVYTTAPGVGGAQMVHQIPTNQ-----------QQFMGYSQIRH-------PPQSG
SAGNPN---------YG--YEYVDNAHTQIYY------TQPMGHA----QYQTMTGP-PP
AMVMPDGS------------AAAKLPAENMTQQIR-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------SSQPL
>gi|109498320|ref|XP_001074557.1|	   884 residues, 50 /line  PREDICTED: similar to dumpy CG33196-PB [Rattus norvegicus]
----------MAVRLNKF---K------------PA------------------------
-----------------------PIPRHPS-LGTHPSAPIPQHPSLSTHPSASAPIPRHP
SPGTRPS-----APIPQH------------------------------------------
------------------------------------------------------PSLGTH
P-------------SA--SAPIPQHPSLGTHPST------------PIPRH---------
-------PSLG--------------------TRPSAP---IPRPQHPSL-----------
------------S---------LS--THPSASAP-----------------------IPQ
HPSLGLST--------HPS-APTPRHP----------------SLSTHPSAPIPR-PQHP
SLD----THP-SAPI---------------------------------------------
----------------PRPQHPSLNTHPSAPIP-------QHPS---LGTHPSASAPIPQ
HPS---LSTHPSAS--A-----------------------PIPRHPSLSTHPSASAPIPQ
H--------PS-LGTHPSAPIPQHPSL--------------G-----LSTHPSTP-----
---------------------IPRHPS-LGTHHPSAPIPRL-QHPSLGTHPSASA-PI--
------L--RPQHPSLDTHPSVPVPQHPSLGLSTHPSTPI-PQHPSLGLSTHPS------
----TPV-PRHPS-L---STHPSASAPIP-RPQ-HPSLGTHPSAPIP--RHPSLGLSTHP
SASAPIPRHPSLG-TR---P--SAPIPRHPSL-STHPSASAPIPWPQHPSLGLSTRPSAP
I--PRHPSLGTHPSAPIPQHPSLS---THPSAPIPRPQHPS--LNTH--PSAPIPGHPPS
LS------THPSASAPIPRHPSLGTHPSAP-----------IP----RP--QHPSLGTHP
------SASAPIPRHPSLGTRPSAPVPRPQHP----------SLNTHPSAPVPRHPSLGL
ST----R-PSALIPRHPSLGTH---------PSAPVPRH-S--S-LGTHPSAPVP-----
------------------------------------------------------------
---------------RHPSLGTCPSASAPVPRHPSLGTR--P-SAPVPRPQHPSLGTHPS
APVP--------------------------------------RHPSLGTRPSAPIPRPRH
PSLGTHPS------APVPRHPSLGT-HPWA----------------------PISLAPVP
RHPSLGTHPSALVPRH------------------------------------PSLGLGTH
PSAPVPRHPSLG------TRPSA----PVPRHPSLGTHPS-APIPGHPSLWHPS------
-------------------LGTRPSAPVPRHSSLGTHPSASAPIPRHPSLGTRPYPSLGT
RPSAPVPRHPSLGT------------------RPSAHIPRHPSLGTHLSGTRPSAPVP--
--RHPSLGTHSSAPIPRHTSLGT----------------HPSAPLSRIVS--------C-
----------------------------------------
>gi|110738033|dbj|BAF00951.1|	   666 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
----------METPLPPLSQLTPNPTPAAAVSSAIPAPV---KGVAVQ------------
------------------------------------------------------------
------------QPIDGSPRAVATDTGG--------------------------------
----------------------I-PEP-------LAAVPGAKLRLMCSF--GGHIMPRPH
D-------------KS--LTYSGGETRIVVVDRR------------ASLSS---------
-------LRSR--------------------LSSMLL---NGRSFTLKY-----------
------------QLPSEDLDSLVTITTDEDLENM-----------------------IEE
YDRAASSA--------TA---TATQRLRLFLFANKL-------ETAATMGSLLDG-TKSD
TWFVDA-----LNQS----------------------------GLLPR---GLSDSAAVN
NTLVNLDEASGGETEIQNLETNVGGE-----NNKRGDLV-ANGVISH-QEMHMSSMPDSP
MMEAAGSSIGSSSS--SP---------------ST-----SNLPPIRVRVSEDQ------
------------RIEEQLAQMTFSNMQTQ-RQFDDGVSLMANRPMMIPPGAMNDAAMAYN
NAPGDGTAPASNGHVSPEDDRSELGVS-TGYRKPPLPMQPVT------------------
-----------IPPRTVGG-YGLTSPDSVASDTSISSATSFSKPMYYQDQPPALPRAPPV
-------AQPETTSAQSSQVLPQTENT---SAQTTSHVLSQPGTYTTM------------
DQQQQQPLAQQPFLHQGVQYIPHPSQYIPIYSHQQQNYPVY---VM-----------SVP
QSQQYIPAG---TP--PLYPNS---------------------KPGTN-SRPEAAQNVYR
AA------PPQVIQLQQQHQ------Y--------MGYAGAPQHSTNANANYGTGAPQHS
TNANAN---------YGGPFEYTNSPNETVYYHTQAPAANTAIPLA--SPYQSMT-PAAA
AAALADMS------------KQMALDGGKQQQHMA-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------ASQPL
>gi|125524345|gb|EAY72459.1|	   670 residues, 50 /line  hypothetical protein OsI_000306 [Oryza sativa (indica cultivar-group)]
----------------------MDSVPAAGV--GVGGGG---AGAGYP------------
------------------------------------------------------------
------------ESTESSPRSRGGDSWD--------------------------------
----------------------E-PFPS-SAAAAAAAAGGGRLRLMCSF--GGRIVPRPT
D-------------KS--LCYLGGETRIVAVERN------------ASLAD---------
-------VHAR--------------------LSRSLL---GGQPFTLKY-----------
------------QLPNEDLDSLISVSTDEDLDNL-----------------------VDE
YDRIAATS--------SGGGSSRTSRIRLFLFPAKP-------ESSSSLGSLLDDSSKSE
SWFVDA-----LNSAISGSL-----------------------DGIPR---GISTDSASV
NCLLGLEDDSSTHSRGGPPNSAPAEE---QRANQQKLAA-AAAVAAARHPHDVQSVPDSP
MIDK-NSSFGSTSS--AP---------------SL-----SNLPPIRVRPEDRPPDSRLA
P------Q---VPVEDHFAQMGISDQPVQ----------PVIGGYMQPPPQVPIPNMA--
-VPSISPSDASS-RVFSDDDKSDHGGGGGRKPQPPKPEVPPVADPTNRAMYYND------
-RSPPAELKRDMPVGTDAASYRVPVPAQDAAAAAAAAAAAQQPPAGYV--YAQMHAPPPQ
-------QQPPPPQQ----QQPVPQQY---VTAQNQHFIHNPATGTFI----------PI
QSYYHHPVPQQAPQPPMPQPVPQPQQSHAFDPNTGMYYIPM---RT-----------NAP
QAYSMPPGAAAVPP--PTLVDT---------------------TPKPTVPIPQMAVKQPE
LQ------QPGLYRTTAAPTPVPASNA--------PAYAGMGYHHVIQTHHHPAPQP--A
ATVAGN---------FG--YDYGDPTRAQVFY------SQAAAPPTLPPQYQPMGSPDAG
QADLKQAR------------A---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------S
>gi|147866236|emb|CAN82042.1|	   549 residues, 50 /line  hypothetical protein [Vitis vinifera]
----------MEAP--------PVVPPAPPLSSGLGVGVGG-PHMSYP------------
------------------------------------------------------------
------------DSVDSSPRSRNTDSWD--------------------------------
----------------------D-PLPS---------VPGAKLRLMCSY--GGHIFPRPH
D-------------KS--LCYVGGDTRIVVADRN------------SSLAD---------
-------LSAR--------------------LSKILL---QGRSFTLKY-----------
------------QLPNEDLDSLISVTTDEDLENM-----------------------IDE
YDRTSA---------------LKPSRLRLFLFPNKP-------ESASSIGSILDNSTKSD
DWFLNC-----LNGT----------------------------NLMTR---GFSDSA-SV
NCLLSLDEDAVANNL----DSSSARD---LEASQP--GG-FGTCKTVKQGQDVHSVPDSP
MLET-SSSFGSTSS--SP---------------SL-----ANLPPIRVHVEDGSGGGSVR
L------QDQKLGIEEQFAQMSVAMQKQ--DEGFVVLSS------------PATAGAA--
-VPVMAGGDYP-NRVFSDDERSDQGMP-VGYRKPPPPQ------------PQQQ------
-PLPPQSQQKSVG------GIDLASPDSVSRQAQAYSLS---------------------
------------------------------------------------------------
--------MQQSNFSEAATGIPSG------------------------------------
--------RSQAPS--APAMVT---------------------SPAAYNPTRNAPLQKPE
MAA----GMYRTGTAAAPLVQVPSSQH---------QQQYVGYSQIHHPSQSIAP----P
SAGTAN---------YA--YEFSDPAHAQIFY------AQAMAPTL--PQYQTMTS--AP
AVVVPEAS------------AQ--LSTDNIKQQIR-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------TSQPL
>gi|110776822|ref|XP_624990.2|	   608 residues, 50 /line  PREDICTED: similar to SSXT protein (Synovial sarcoma, translocated to X chromosome) (SYT protein) [Apis mellifera]
MSVTFAQRGRPPPNPAQIQKMLDENSQLIQTIQEYQNKGKPQECIQYQQMLHRNLVY---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------LASIADANQNIQALLPPP---QGIPNGPQHGMMNPQGLPNA----
-PTGSSGPAGDMPPN-SQPTLPMSSFSQGQPMSQGYRGPVMPGQGPAINRPPAAPGPQQY
RGP---QGYPQQ--PSQQTYPAQYANQNPGSNYQGPQGSAYTPGQPNQYGPPNTSQQQGY
STSTQPNYGPPTTVNSYGPQPGYPPPGTTQPPT--------GYGPPPPPNQQGYPPSN--
-PSQQNFPSSG-QQ-------QPGQYG-SPSPQPNYQQPPS-QAPPQNAYGGGQP---GN
YPPPSSQAYANNV-----PPQNYPAPPTSSAQPPQAGSQQ-NTGPQPNYGNQPSPGPGAT
QYGPAST-SPPFST-ASASGVNTYAQSSQPTSTPSASTQTYPPNSAPPPTSQGGNYAPPG
PTPSGYPVHQTPHPSSHPPHQPPHQSPHQPPHAPHQPPHQPSHQSTHQPPAH--QAPHQP
QQSQQQSQTPPQSQQQQSQSPAPS---------------------------GFQPPSGP-
-P------QGPAPPPGAGPQPGYGPATTQTYVPPTPGGQPQVYTPHPPQAGQHYGHPQYP
Q----------------SYPPPPAGQGYPQYP----------------------------
-----------------------PRPPGGHMPPPPGPQGPPPPNQYGGYGYQPP------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------PQ
>gi|115333977|gb|AAI22566.1|	   641 residues, 50 /line  PCLO protein [Homo sapiens]
AAGGGASGAGSPSHTAIPAG----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------MEADLSQLSEEERRQIAAVMSR
AQGLPKGS----VPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPGLSKSRTT--
DTFRSEQKLPGRSP--STISLKESKSRTDLKEEHKSSM--MPGFLSEVNALSAVSSVVNK
FNP---FDLISDSEASQEETTKKQKVV------QKEQGKPEGIIKPPLQQQPPKPIPKQQ
G--------PGRDPLQQDGTPKSISSQ--QPEKI-------KSQPPGTGKPIQGPTQT--
-PQTDHAK-------------LPLQRD-ASRPQTKQADIVR-GESVKP-----------S
LPSPSKPP--IQQPTPGKPPAQQPGHEKSQPGPAKPPA-----------QPSGLTKPLAQ
Q--PGTV-KPPVQP--PGTTKPPAQPLGPAKPPAQQTGSEKPSSEQ-PGPKALAQPPGVG
KTPAQQPGPAKPPTQQVGTP---------------KPLAQQPGLQSPAKAPGPTKTPVQQ
PGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQP--GPAK------PPPQQPG
SA------KPP---------------------PQQPGSTKPPPQQPGPA--KPSPQQPGS
TK---------PPSQQPGSAKPSAQQPSPAKPSAQQST----------------------
---------------------KPVSQTGSGKPLQPPTVS-PSAKQPPSQGL---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------PKTICPLCNTTELLLHVPEKANFNTCTECQTTVCSLC
GFNPNPHLTEVKEWLCLNCQMKRALGGDLAPVPSSPQPKL
>gi|115449415|ref|NP_001048461.1|	   585 residues, 50 /line  Os02g0809100 [Oryza sativa (japonica cultivar-group)]
--------MALRLRLRVVSGSTPATHGRTSAPAHHPSWP---------------------
------------------------------------------------------------
---LGPW-----AIVRAGTGDTGDGEAVWAVPPSPLTPLSPIISS-------PTLTRAAA
AAMADSGDSSPHSAAATDDAHHEGSEAAAAQAAPPPPAPPAKVRLMVSY--GGRIQPRPH
D-------------HQ--LSYVNGETKILSLERP------------LRFAD---------
-------FAAR--------------------LAGLAG---SPGDFCVKY-----------
------------QLPGEDLDALVSVTNDEDLEHL-----------------------VLE
YDRLHLLRPAPGSGGGSSR-GGSTPRLRVFLFPVQ-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------SPTPPPPPQ---
--------------PSGLLEPKQEQRQWFVDALN--------------------------
--------------------------S-VHQPPPPSPPQPK-QESVSVQSP-----PPAV
VPMPQPPPVLPAPTGPDYL---FGLDNGFVPPPAVKVK-----------DPAGDPPTVKD
N--VPVE-IPAKNDDRHTTNPVSDHVVVSPVVSPGEFQRQIQGLEKLQFADTAAQQPPPP
PAPATAAP---------------------------------PPAALPRNGSDDSLTRAYP
PATVTPTPPTATPE---YYLPKYQEKPAAPPPSSAPPPTAF--LPVPGRYTSVAPG----
-----------SGADHAPVFFIPAPPHGYFTTAAGPGATSFPAVYAVAQ-----------
---------------HNGNANASGNGPSPAAASNAQAY----------------------
-------------------APQVAYDSNGHAIYYTSVLP-QYASAVSGVPA---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------AATVLGTDPAKPVAVKPTVS
>gi|115471827|ref|NP_001059512.1|	   862 residues, 50 /line  Os07g0438500 [Oryza sativa (japonica cultivar-group)]
----------MEPRRDDV--RSAAQSTIHGSSSSAPTSSPVPDYPISGSVKPVLNYSIQT
GEEFALEFMRDRAIPKKHLVSGMSHD-----------------------------QNVAS
GAGL--------------KDPRGLLGAHRTGAESRFDAAIFLTTDIQQTEGIERKSFAEN
ENRSRHVSTSSVPRI--PSRSGSSQRLSHGYASSESSDSSRRIKILCSF--GGKILPRPS
D-------------GK--LRYVGGETHIIRISRN------------ISWQE---------
-------LKQK--------------------TTAIYN-----QPHVIKY-----------
------------QLPGEDLDALISVSNDEDLRNM-----------------------MEE
CGFLDNGE--------------GSQKLRIFLVSSIDF-----DDMSFSLGSM---DSDSG
IQYVVAINGMDVGTTKPSSGHGLGNTSINELDQFIN--LNND------------------
------------------SNQPNSSRDGSNLYSMSAST----------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------AVPPALISVPLPV-TLSSDSTANLYPYHSHGM
QHVQGSDYSLPASSERFYDIEGQTS-----------------------------------
----------IPL-SVPSGYRYTSQCTPYSGTTSLQSFDQQSYHDSMMEGSMKEEKQPSV
RVPLQKNDLDYFQSLENMSVPVIHHDSSSTNYMNSDVPVTTSIQEGL-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------KSSLQPSDSAKSLETYTASKAMSAAQDSECN
EDDRHSSGAFASGCSDFQVDMMDHSNKNPPPHSGR-------------------------
----------------------------VFHSERIPREQAGSLNRLSKSDDSLNSQFLIL
QSQSGVAKESIAEASDPAIEGTEKSNLDARAINLNDPATVDSVTPEKECANTVQQTSTFS
EQLLGEKRSSTDMSTRNVEKNMHAAENAVA-----------KCNLNDATSDGTKIVNQQA
DHSAVPHHVSWDTPNPAIPTDVGCDPFVPSTSSLDDSHKEPIIPKKDNKDIVGGMSERTS
PDILSDFFANTAAQSL--------------------------------------------
------------------------------------SPFNEPVLSLNMHNY---------
EPQRWSFFRNLAQ----------NEFEHKNKEQDLAKIEEGVYPLVHAEH--------DA
VNVKNVAPQND--------------VHLETYPVSSGIN-L
>gi|115926275|ref|XP_001195649.1|	   785 residues, 50 /line  PREDICTED: similar to Cyclin K [Strongylocentrotus purpuratus]
MPCWYYEKEDLEHTPSIKDGIDPGTEARYRREGSRFIIE-----------------AGTT
QKLRYDTMATGVVYFHRFYMFHSFK-----------------------------------
-------------------------EFPRYIMGAACLFLAGKVEE---TPKKCKDIIKIA
KNILSEQHFAAFGDDPKEEIMTHERILLQT----IKFDLQ--------V--EHPYSYLLK
YAKTFKGDKDKIQKLV--QMAWTFVNDSLCTRLCLQWEPHIVAVGFLYLAG---------
-------RLSKSDLMDWSGKSSKSKWWEQLTEDIS-------------------------
--------------------------------------LDIMEEICHKLLDLYAAGQHKG
PTSQGTPT--------KAP-PPKRPKPKSAQDGSHGDPKAKMIKQE--------------
------------------------------------------------------------
-------HSREKQRH-PPPPPPSAGTAPPVHPSQANAL--HERR----------------
-QA---SPAPPPPP--RVHTSGYPSNA------------STHKPHPGSSVLPPPQPPPQK
Q----------APPPQQQAQPHQAPPLQVPPYQA--------------------------
-------------------------PQ-QQAPPPQAPHVPH-QVPHPATHI-------VT
HPVPTPVPHSALPHQPLQ--TQHHQPPVMHHQPPQPALQT-AVPQVPPPPATVTHPNPYQ
Q--VPAY-THPNP-PVSTYAAPQYSAPHYSTGSV--QPPMLPPATQTQPVIPPPAPAPAP
VSSSGHLPPSQPPYQIQGQFMNHPPPAAMPHAYRPPPATTPAQQYH-QPPPVQSAVPQQP
PIYRPPPPRPAVPGMPQTTATMPLQFPPRQLPPPGQLPPNQ--APPSLP-NQYQPPTPPI
PT--------PTTQYRSHTPPVSHPVAQSQYSFSRSQSDETTPFPAVPSTATSAAPPPPG
I--------------VPNYPPPTSSQPAPGQPPLDK------------------SMMSIA
QEYAAQQLQSLGVPRNVAMQPVSGFVGQQQQQQQQGTTN-QPPGTVAQQPQQQQQ-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------QQQLINNPRLRYTVCK
>gi|121705308|ref|XP_001270917.1|	   527 residues, 50 /line  cell surface protein, putative [Aspergillus clavatus NRRL 1]
----------MVKAGVALVAFAGPAFAGVIGTGSHDQVS-----------------LLAQ
ACP---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------SCSIMLTRENSKPHVGPTAPI--KPPSNS----EKWTTTTEPH--
WVTKTTTFVTTSCP---------VTHSTVTSGTKTLTV--PITLTETVTLTTTTVCDLNT
EPP---EVIVPTGV--VTTKPLVPTSV------TTTETVCTTCHHNNTTVPPHSSTYVPG
H--------NTTIVPPHSTTQVPGHNTTIVPPHS-------TTQIPGHNTTIV-------
--------------------------P-PGTTNGTIVVPPT-SVPSHNTTVIPPAPVPTQ
NPGQNNT-VVPIPPKPA--------PFTNSTVPSVPT-----------VQPVPVPPVVPG
Q--PSVP-GQPSV-PGQPSIPGQPSTPGQPSTPGQPSLPGQPGVPEQPSTPGQPSVPGQP
S-------------------------------TPGQPSTPGQPSTPGQPS--TPGQPSTP
GQP-STPGQPSTPGQPST------PGQPSTPGQPSAPGQPS--VPGQ-----PSTPGQPG
VP------EQPSTPGQPS-------TPGQPSTPGQPSVPGQPGVPEQPSTPGQPGVPEHP
STPGQPAAPGESS------------------VPGHPETPAPSA-----------------
----------------------SPAQPSGVSPVSPSESS-HPFTGSAAQSFKPA------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------AGLLAGVMGLMLLL
>gi|121918272|gb|EAY23041.1|	   677 residues, 50 /line  omega gliadin, putative [Trichomonas vaginalis G3]
MQ--------NNNGGVNR--QTQPI-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------P-EFNQRFYPQNYPQRGPSPNDFQQRNPP-------------
------------------------------------------------------------
---------PNFKPG-YPPNYPVRDNSPQNYQI-------------DYEIRSNSPQNYQN
FQA---RDNSPQNF--QG---------------NDFQQQVSRQQPPQSNNYPPGFIQQN-
-------------MANRNASPQDFHPR--------------NMSPNDYAMRNTSPQN---
---------------------YPPNFP-MRDNSPNMYQQNQ-AFQHRDNS----------
----------PQSFNPEFRPSMQVPPSYQQRGPSPQDYHV-RTQMQPNYP----------
-----------MR-DPGMQQYPQRGPS-------PNQYPQNPQMYQQRNPSPNSFQPNYP
MRDQIPPNYQMRNA-----------------SPQNFPQRGPSPQNYPVRNTSPQSFPQRG
PSPQNYPVRNQSPSSYQPRGPSPTGYVARGPSPQGYPARGP--SPQNYPVRNQSPQNYPV
RN------QSPTGYSTQQRGPSPQQNFQP---QFQTYQQRYPQQTVSPQ--NYPNRP---
------QEPQPQPQFNPDATLPFGYDPMFGRAAERPRFPQPISIPQQPMDMPQQEERLRD
EFEAFSAQNNQQSPESQTIPSENQQIPQETVQQQPKQEP-PKPPKPANQPSDAWT-----
-------------DFEDFAKREVEDNV-PQFNSFNNEMMLPPSSMMVALKKDEEIPSSD-
-----------------MDVGSQESETSGDSTQSTHSTQSTQSVFSVTPQESQFLDINGE
FLESLSLMRTAGMTEQALYNFTMLLAPAPPTADPIEFDPSLAKRVIP-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------APPRFSRTPMGAELRANCQQLLNYTFVFNNI
>gi|125556267|gb|EAZ01873.1|	   908 residues, 50 /line  hypothetical protein OsI_023105 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MIEE
YDKLAGAS----------------PKLRVFIFPISDA------AGGGGGEEAEGGGFDAG
LRYLEAVNGI-VRKDSVASLSSTQNSDGGPPPPAPT--SGGGGGGGGSPTALSPTST---
--------------C-SNDAARSAFGVAAPPPLVDVFS--NAAAPAPVPVKPQEIAAEVR
APP---QAN--------------------------PQPEAARYRQPLSQLPPLPPVFMND
H--------REAMQGLNQAMPGNGGRLEDCNMCL-------KALPHAHSDPVVNDYGS--
-DMHG-GPGPE-TVPVYMSLRPEDVAR-IMMPERAVPVPMG-AYGYTHMHPVPHERE---
---------------MMYAQQVEGIPNTVLIDPSGLHQHV-YVHQQQQVPPQQLPSTYGF
N--Q------------------------------------IPVIPNEKDRVVSPGSAHSD
ISSSHQHIMQQPLPPQQQQQLPSGQGMAQYPVKQNSPNNQLTGEGSLSGNARHREDGLTR
RDNVSPVAPAAVPTYMANVDRMMDSLRLSPSEASSASTEQR--KPVM--PPENGVPQNAI
PE----------------------------HSQGFPDTRAREVSQSNTNTFFDVSEPKVV
LPTEPALSPSIASSYLHNV-QHTNVSHMPHMMSIGG--PYSSYVVATVGPGGVPPSAYGV
DLVYANS-A------------VN-------PLSDDMTSP-DLVSVEDSLPTSNTKSSEPQ
PPVVNDGVGAVTDVSLFMSSLMLSKRIMQVNKSRPADWISGFPATDDLGRLQIIKNNDLE
ELQELGSGTFGTVYHGKWRGSDVAIKRI--------------------------------
------------------------------------------------------------
----------------------------------NDRCFAGKPSEQD-----K-------
----------------MRNDFWNE-ASKLADLHHPNVVAFYGVVLDGPGGSIATVTEYMV
NGSLRTALLKNAKTLDKRKRLIIAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPI
CK----------------------------VGDLGLSKVKCQTLISGGVRGTLPWMAPEL
LNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLRPAVPDSCDP--
--EWRSLMEQCWSTE---------------------------------------------
--------------PSERPTFTEIAGRLRSMAASHKVQ-P
>gi|125586577|gb|EAZ27241.1|	   808 residues, 50 /line  hypothetical protein OsJ_010724 [Oryza sativa (japonica cultivar-group)]
----------MDWREPAN--ICEQKLPTK-------------------------------
------------------------------------------------------------
------------------------------------------------------------
RPYPSLSDTSSEGSCNRYPRN-------------HYDDTPMRIKFICNF--GGRFLPRPS
D-------------GQ--LRYVGGERHLIKISRD------------ISWKE---------
-------LICK--------------------TSKLIR-----RAHMIKY-----------
------------HLPGEPMNMLISITCDDDLRNM-----------------------IDE
CIVLERTK--------V--------LLTVYLFADNDD------ERHVHFVLGSSSSTDKE
AQFIALVNGL-VRPGEELKKQRLRNTSANDLDQLMF--DINEEGLLARTDKASPNVQS--
KLSPSIVKVPLKTSR---------------------------------------------
------------------------------------------------------------
-----------------------EQLE--------------NMPPSSQLAVTNQDYKA--
-PRNEDNPLCT-ARKTNNAH-LGSSVP-SESTCIGKVEAGA-HAVSR-------------
-----------------HHPGQRNTATNMTRKSNQATEDQ-VKGSPRKQLPIQVDSRGVN
V--VSSN-SNNNS-LTMHIHLPVYEKVASLSGGSEKTVNQPTSHDNKMKLKTYSTQEEAV
SHSASHNKTEMHKRSL---DFPTPSRCHDDTYNSTNSTNLHILEKSITTNNKQKQQPAVM
CIDILKKNHPPEPTK---------------------------------------------
--------------------------------------DKTTELQKNILVRSSSERQERP
NSPKPDEHLSTARSRSVGADRISPQIRTPSQESKDN--VAPFIEESEACETKNSEEALSA
NTVMGRE-LISNVQVINNGDL---------------------------------------
-----------------------------------------------------------E
DLREIGSGSFGTVFHGRWKGTDVAIKRI-----------------------KNSCFMYPS
SQADK-------------------------------------------------------
------------------------------------------------------------
----------------LITEFWRE-AAIISKLHHPNVLALYGIVNNGPGGTLATVTEFMI
NGSLKKVLLHKNKYLDWRKRIMVAKDAAIGMEYLHSKDIVHFDLKCDNLLVNIKDPSRPI
CKDIVYKTG-----------GRNRQIMVQQVADFGLSKMKQATLVSGGMRGTL-------
------------------------------------------------------------
----------PWMAPELLTMSGT----------------KVSEKIDVYSFGIVMWEILTG
EDPY----------------------DGMHYGGVIGLQ-N
>gi|125978022|ref|XP_001353044.1|	   707 residues, 50 /line  GA13423-PA [Drosophila pseudoobscura]
------------------------------------------------------------
---------------------------KLIRYRRQPPYSVIKGPSKRSKLRRRTKGPPPS
KLKYGPP-----VPP---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------PSGHYR-HGYRHKPSFPSSH------
--------------------------------------------------------IEEP
SFSIDDFQHL-KFDGGDFKIPTSS--------------YEAQS-----------------
------MDLDFYSHD-PEPEPEPDLYGAHKFPSLDFSL----------------------
---------------------------------DSPHISSGSAYDHVPHQKYG-------
-----------VPPLHQSYQPVDHSFA--------------SHYEPP-------------
---------------------PPAPPS-TRYGVPTAPVPVP-KIPNVGYHQ---------
----------------------------HFAEPPKPKPKQ-KPQPQPQHP----PVHSSN
F--EIAY-SPPAF-EISTSYQSNQHESYIPSHQSNEGSFAEPPVPQHPPTNYAQP-PEHP
SSGYVDPPEHPSSGYA---EHPPSGYLEHPSSGYEEPPQHPSPNYAQHPSNSYSQPPQHP
PSSDYAQPPQHPPSSDYAQPP-------QHPPSSDYAQPPQ--HPPS--SDYAQPPQHPP
SF------DYPSNNYAQPEPQPNHPSQSYPQEDYSPPSQELPLNP---------------
------HHKFPSFDFPKSSY------EVPIYDPIPF--EASTKEEQQES-----------
--------------YPPILSDHS-------PVPVPNDIA-EDDTH--------AAGSTKS
STKRR-------K----------------------------------------------R
KRVPNKHTLDVPELQQAY-----------------------DADSHLRGGAQPDADAHGS
HYV-----------------------ERKQTFVNFVTPTTST------------------
-TTTPSPWSPMVRLRTTSSTAFIPTIVTST------------------------------
------------------------------PSTRTTTHTRGRNRGSSRYRSA--------
-----------------------------------------------QTVASSQSPEPIS
TSVSIEKSRSKSYYDGT------------------IAPPIQQQFSTYGGRGTRPTRPASY
AALQP-------------------------------------------------------
---------------AASNKRTTKGVFDTTLFKSPHS-----------------------
----------------DREMERNRNIHVLRQNLPKNHKLY
>gi|147778293|emb|CAN65141.1|	   540 residues, 50 /line  hypothetical protein [Vitis vinifera]
MP--------LPHQKPVA--VANFQSTEAGGRPSHLETS-----------------ILNL
NNENWIAWVPCYAVRRVYIWLVT------------------------------VHGDSGT
YRGFYPI-----QVLFLSFSLRHSTEYYWRKIKDKLTRSFRRLFF---PEPDTLALIGMA
SHHPSELDSVASDSVASSPRSDY-----------PTHDIQPRVRFMCSF--GGKILPRPH
D-------------NQ--LRYVGGDTRIVAVHRA------------TTFSG---------
-------LLLK--------------------LSK-LS---GTTNISVKY-----------
------------QLPNEDLDALISVTTDEDVENM-----------------------MEE
YDRLALSG--------IG---LKTARLRLFLFPSDDG------SRASSISSLLDGSSKRE
NWFFDAINGG---------------------------------GLER----GRSEASS--
IVSEVPDYLFGLDNS-DDIQALPRESKL--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------KTRTALAEN-VSVSDPGSPAPAI-TSPFCSTS----------
------------------------------------------------------------
------------------------------------SGPSVPAIPDLPPVKTKPDKSIPP
VEVKDNPPEGFADVIE---P--A-------------------------------------
-VPQSGGYAGNPMWHYNPDSHY----------------------PGQ--PVHQIPVYYVP
-------------------------------GPVPPGNMPVQSVPVRPQY----------
---------------VPQYPGPPGQIPVGFRHPGPG--MGQVYG----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------GAI------------------RAVGPMEGYDMPMRVVSDGMNQQVYYGV
RTTGMVQAYPPG---------------------------------------------MVV
PAGEEFQGNGSDKKPGRVST-------------------T
>gi|21326031|gb|AAM47576.1|	   666 residues, 50 /line  choriogenin H [Oryzias latipes]
----------MARHWSIT--VFSALALLCSFLG---------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------TEVD-AQKGNPQDPKV---PYPPYYPQPKPQDPQHVS
PPY---------------YPGKPQNPPQKPSNPQYPSYPQ-T------------------
-----------------PQNPQVPQNPQVPQNPQYPSYPQNPSYPQNPSYPQYPSNPPTS
QN--------PSYPQN---P--KLFQDGKPSNPQQPQVPQYPSKPQPPQNPQVPQYPSKP
-QPPQNPQVPQYPSKP--QPPQNPQVPQYPSKPQ-PPQNPQ--VPQY--PSKPQPPQNPQ
VP------QYPSKPQPPQN----PQVPQYPSKPQPPQNPQVPQYPSKPQNPQYPSKPQYP
QAPQ-------QPQNPQYPSKPQDPGKNPNTPPIGP--PPP-------------------
--------KSCEVPRDVRVPCGV-------PDISPSACD-AIDCCHDGQSCYFGTGATVQ
CTKDGHFIVVVAK----------------------------------------------D
VTLPHIDLETISLLGQGQDCGPADSNSAFAIYYFPVTYCGTVVMEEPGVIVYENRMTSSY
EVGVGPLG-----AITRDSSFE-LLFQCRYRATSV------ETLVVEVQPPDSPLSIAEL
GPLN----VYLQIANGQCQTKGCDEAAAAYTSFYTDADYPVTKVLR--------------
DPVYVDVQILGRTDPNLVLTLGRC-WATTSPN--AFSLPQWDILIDGCPYAD--------
-----------------------------------------DRYLSALVPIDHSSGLPFP
THHSRFLFKMFTFVDPHSME----------------------------------------
-------------------------------------PLREKVYIHCSTAACVPGQGVSC
EPSCSRRKG---------------------RDTEAVA-----------------------
------------IRTDERRVVVSSGEVLMLAAADEPSE-Q
>gi|22331316|ref|NP_189115.2|	   756 residues, 50 /line  octicosapeptide/Phox/Bem1p (PB1) domain-containing protein [Arabidopsis thaliana]
----------MSDRWARQ--NAERPATTLAERRNVNKNV-----------------SLQT
GEEFSMEFLKDHTPVQSPIVAGRTHNDVHRFGD------LYYQNQPQGYDSAARFHELRR
IESECPS-----DAYDFGRDPRSTIRLENGGYMPHFNAYHNVGCD---KEVITRKAFGEI
NSNRGDVTGMSAPCVFLPERTQSNNFTGGG----GDFDRFGKVKFLCSF--GGRIMPRST
D-------------EK--LKYVGGETHIISIRKN------------LSWEE---------
-------LKKK--------------------TSAICQ-----QLHSIKY-----------
------------QLPGDELDSLISVSSDEDLQNM-----------------------IEE
YNGLERLE--------------GSQRPRLFLIPIGE-------PERKAQQNIPDC-Q---
------YAAA-LNCN---ADPNPR--------------NISDGQ----------TLAG--
DSRYHINNLDRNPS----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------FCKRTPGQMLRLDATAMRPNPLFNGV-------------
-------------------------------------------------QYNMASYPSPP
------------------VSPSPFQQRDSNGAYSQFHGNNS--SSES--NNSFTPAQQD-
---------------------------------------------------------TSI
FEVIDSKYHQQR----------------------PL--PSVNYQSNKQEAENLYGIQFQN
GFNDKPV-TPNLGHVD--------------------------------------------
------------------------------------------------------------
-----------------------------------NLCFNPERSANNGRVFYDKVSMPEE
S-------KVSFSGSTNSNDSC-LGIPHSYSDSTLEITGGHSSYFSQERQQSPSSTLNFT
KKQTQEKQVQVHRNNDLADRRTQSDILDMKSTEGGETMFKFSPSPRG-----PRLS----
------------------------------------------------------------
-GENKTLHIDISAAGNHYDEIYLN----QETKNQGGNSDT-IFHLGGKVLGT----RAMP
TDMEGKKLPIYGNQTSVVVDPWKQIKQDNERLMAGAGTSSANLISLE-------------
------------------------------------------------------------
--------EGIAANTPNEEPESR----------------AARERNLEVSGIF--ISKRVV
SDENFLFSIASESPNSKIVHETQKNVSITKCTLNRIVL-Y
>gi|24641923|ref|NP_572941.1|	   662 residues, 50 /line  CG11584-PB [Drosophila melanogaster]
----------MKPFAFIV--VAALSLVVVSGRPGAQYLP-----------------PLPV
KEVSAAQSFQQLVQTQLQQHIQSQIHPQVESIQASVPLASFTIQSSGQQQYQSAPAPAPA
PVSIPAP-----APVVNSA-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------PAPAPAPVEVQQPAPQVIYEAPKPVIATQT-AAKN
AYLPPAPVQQ-FVPA---PEPVVA--------------NIAPQQETITTTYNAPAAAP--
VPAPAPIAIPVPAV---------QEQHQVIQQTYSVPA--PAPA---VQQSYSAPAPAPV
VQQ---TYSAPAPV--VQ---------------EQTYTAA-----------------APV
Q--------AVQQLTYSAPAPVTQEQY--------------YSAPASVVQQTSSAP----
---------------------APAPAP-VQEQFYSAPAPAI-QQTYSAPAPAPVVQQTYS
APAPAPQ-QTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQT-YSYPAPVVQQAPVVQAVA-
Q--QAPV-VQQSY-SAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQ--------------
------APVVQQSYSA---P--APAPVVQQSYSAPAPVVQETIQQAPVIQQAPV------
-------------VQQSYSAPAPVVQETIQQAPVI----------------QQAPVVQQS
Y-----------------SAPAPAPVVQQSYSAPAPAPVVQESIQQAPVIQQSYTAPAPV
SIPEPVQQIVQQPQYSGYSYQTPQQAPAPIQQSLPA--PAPVVISAPAPAPAPAPVQLQQ
SFVPAPP-APIQIQ----------------QPAQPIVQY-SPP-----------------
------------------------------------------------------------
----------------VVQQQVTYTQPAPAPIQVAAA-----------------------
-APVAVSAPAEIG-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------TNYAANGGYL-Y
>gi|26984057|gb|AAN85204.1|	   834 residues, 50 /line  calcineurin temperature suppressor Cts1 [Cryptococcus neoformans var. neoformans]
----------MSTPIEPK--ELGTLIVVVGKARNLP------------------------
-----------------------NKSRFG---KQDPFCTVIVGEEKQKTKPIKR------
-------------GGQHPEWDEEFRFAILE--------------D---VEDVVQRSES--
----------------------------------------QSESLNSSL--NGKPLPVPD
DPGVITTAALASKSRK--IKKKGGKSMKVACFADDAKEPELIGDCVVSLED---------
-------VLKKGEVDDWYDFQYKEKYSGEIYLELTFF---SNEAPPVKR-----------
------------NVPRPSIPRYGPPSLNGSNSSMSFGSTAGKGALPQLSSGSISGANLYI
PPYAPQAA--------RVP-SPASQPGQSTSFADLGLPSGHRKSSPLPPIQQAQH-GYQP
SFSSSLSVNS-RASV----------------------------DVLTR------PMSS--
MSLNPSVNSFSMSSA-PAPSAPSSSYGHSHRHSFGGSS--EAPWGSVLPHSGYAPAPTPH
LRP---ISTQSIGA--GS---------------EAPWGSMLPQSHPAPAPTPHPRPMSTN
D--------A-LTGEQTMRMEADRLRT--------------AATPMLRPSSGMSHGAA--
-PASL----------------APPVAP-ISAPSPQDSRITS-TIPES-------------
-----------------LRPAGPPQPHQHYSQPPPPFTSN-QYHGQPPTPA---PPLHSH
S--AGSI-SPVAT-TLGHYQVPSSSFSGLAQPPGDSRRASSPGPGYYAQQSAGQFQPQCQ
VNGAYGSPVGGNGY------------------------GQREGYSTPTRSNIYP------
-VPPAQDHQQSPPSSQGYYPPQPPQTPQSYPPQS--------------------------
-----------------------SPTPQPYYQTLPPAHQQQPPLPPAPP--QSYAYSQSS
V------------------------------LPHRQ--PSPVPPPPQPQTNESGYVPWYQ
QTQSAQP-QPQSH------------------TPYPQSHT-PQPQSHTPLPQSHTP-----
------------------------------------------------------------
---------------LPQSHTPLPQSHTPLPQ----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------SHTPQPQSYPYVQ
QPYGQQPQHQGSAG------------------LITYYLLHRNILNHFHLP----------
----------HLCPKGAHSPRLQRLLLPGHH-------------------LGITLQMSCI
CKGKKVGTLTGDEK---------------------SNV-M
>gi|28972231|dbj|BAC65569.1|	   882 residues, 50 /line  mKIAA0458 protein [Mus musculus]
-----------EISRPNS--PSEGEGESSDSRSVND------------------------
------------------------------------------------EGSSDPKDIDQD
NRSTSPS-----IPSPQDNESDSDSSAQQQ--------------M---LQAQPPAL----
-----------------------------------------QAP----------------
----------------------SGAASAPSTAPP------------GTPQL---------
-------PTQG--------------------PTPS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------ATAVPPQGSPATS
Q--------P-PNQTQSTVAPAAHTHI--------------QQ-----------------
---------------------APTLHP-PRLPSPHPPLQPM-TAPPSQSSAQPH------
-PQPSLH--GQGPPGP---HSLQTGPLLQHPGPPQPFGLP-SQPSQGQGPLGPSPAAAHP
H--STIQ-LPASQ-SALQPQQPPREQPLPPAPLAMPHIKPPPTTPI-PQLPAPQAHKHPP
HLSGPSPFSLNANLPP---P--PALKPLSSLSTHHPPS------AHPPPLQLMPQSQPLP
SSPAQPPGLTQSQSLPPPAASHPTTGLHQVPSQSPFPQHPF--VPGG--PPPITPPSCPP
TS------TP----------------------PAGPSSSSQPPCSAAVS--SGGSVPGAP
SCPLPAVQ---IKEEALDEAEEPESPPPPPRSPSPE--PTVVDTPSHASQSARFYKHLDR
--GYNSC-ARTDLYFMPLAGSK--------LAKKREEAI-EKAKREAEQKAREER-----
------------------------------------------------------------
---------------EREKEKEKEREREREREREAERAAKASSSAHEGRLSDPQLSGPGH
MRPSFEPPPTTIAAVPPDTPAL-RT-LSEYARPHVMSPTNRNHPFYMPLNPTDPLLAYHM
PGL--YNVDPTIRERELREREIRER-EIRERELRERMKPGFEVKPPE------------L
DPLHPATNPMEHFARHSALTIPPAAGPHPFASFHPGLNPLERERLALAGPQLRPEMSYPD
RLAAERIHAERMASLTSDPLARLQMFNVTPHHHQHSHIHS-HLHLHQQDPLHQGSAGPVH
PLVDPLTAG--------PHLARFPYPPGTLPNPLLGQPPHEHEMLRHPVFG---------
-----------------------------------------TPYPRDLPG----------
-----------AIPPPMSAAHQLQAMHAQSAELQRLA--MEQQWLHGHPHMHGGHLPSQE
DYYSRLKKE-----------------------GDK--Q-L
>gi|39581822|emb|CAE60715.1|	   594 residues, 50 /line  Hypothetical protein CBG04386 [Caenorhabditis briggsae]
----------MKLKLTIL--LALVGALFAAPSDLHW------------------------
------------------------------RHHHHHHHHKTKAPRPTKGTTTTLAPPTQA
PIIVSSA-----APIIVTDAPSSAAPEVPS--------------S---STPEV-------
-----------------------------------------PSEAPSSP--TEEPIKSTS
G-------------PF--QPSEEPQPSAEPSDKP------------DPSSP---------
-------PSPG--------------------PM---------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------TKGPQPPNPPEPSDEPE-------PSAEPSEQPSDAPQPSVQPS
DEP---QPS----------------------------------DQPEPSAEPSPEPSEQP
S--------PRPVEPSEEPEPSDKPEP--------------SVEPSADPQPSDEP-----
---------------------QPSAGP-SDEPEPSAKPQPS-EEPEPS-----------D
KPEPSAE--PSEQ------PSDAPQPSAKPSDEPQPSDQP-EPSVEPSKDPQPS------
----DEP-QPSA-------------------------------------EPSDEPQPSEQ
PEPSAEPSEQPSDASS---P--GPVG----------PSEEPEPSDKPEPSVE----PSED
PHPSAEPSEAPQPSAEPSDEPQPSSG----PEPSVEPSKDP--QPS----DAPQPSAEPS
DE------PQPSEQPEPSAEPSEQPSDASSPGPVGPSEEPEPSDKPEPS--VEPSEDPHP
SAE---PSEAPQPSAEPSDEPQPSSGPEPSVEPSKD--PQP-SDAPQPSAEPSDEPEPS-
AEPSEAP-QPSDKPQPSDKP----------QPSGPPSPP-PRPTRRPGPPTRRPP-----
------------------------------------------------------------
---------------PPTRRPVRPTRPTGPPGPPTR------------------------
-RPPHHHTGKGVFYFDF-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------VDK-K
>gi|46126241|ref|XP_387674.1|	   858 residues, 50 /line  hypothetical protein FG07498.1 [Gibberella zeae PH-1]
----------MDLRSVLN--TSEGGDRA--------------------------------
--------------------------PVKSAPKPQPPPPVH-QHQQQPHPQQQQQQQQMQ
RPSQSPA-----Q--------APASHPYYR--------------E---YNRQPPPH----
-----------------------------------------PSPGKPMP--QEYLPHAAH
P-------------HH--PQSRPPSHHQPS------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------PHQPPPG--------------AYPPQSPYQAP--------
------------------------------GPYPGRPVPPP-LQPGGSFHDARSP-SG--
-------------------PTPGQSPYRASTTPSAATAAA-GYPFPHTQSPAEV------
----ASP-VQRHQ-HSPAQYPPRESFSQGPQVIPPGHVHGYPATQQ---------QQHHQ
NSIPQTPPVATAVNQQ---Y------------NQRPPSASRSTHSTPTPTSAHTQHPYGF
VQ----GSSPVVASRPPPAEYGHSRQPSQPATPVAPPL--------S--SGSRQPSVPGV
FA------QPSSPYQQRLSYTAAAPVAQAQ-----------TQVQAQVK--SSPPPPPPP
TKRISSSYGSPAPDAHRRSQSHSERAPSPSVSPKS-------RVPSLHSNPDPLAALAAA
DAKNKQS-QPLSLPQPMAIDTE--------RAATPAKRK-LEDRIFDSSPQEPEE-----
------------------------------------------------------------
----------------KRIKSSETNGGQIPVKRESVSDL--PLSRRRRRYSQPPIWAQDS
RRMAGMPSNANFVLQKRLHSHI-NG--KQEQKPRPS------RHASPETNRTAPPPTEPA
PQEILGPWEPSITGVKPFEDISRKV-ADFLFLNVLNAPDMMEISSKS-----IQFEVEAK
LGTLIDKDTRYRVNQNIASECILMDS------------------SRIAFESSMTEAAHKK
NNDFLNEIVKSTHPRGPGGANHR----VPVVYKHRRERDR-FFDLPAELQHRIPGC-IRN
RLAKGRRTRVRVTHDQKTQEVLGKIIKARVADLDIHFPELPMDCRI--------------
-SINLEMDWDGSLE------------------ELEGIPNPGDNPDRNKDRLSYTQGPYQI
DLTQVIQSGPGGRPEKKHELEIE------IDSKLLID--QGRKAANGVAHRYPELVEGLV
DNIRVLARKAR---------------------DFE--Q-H
>gi|47497159|dbj|BAD19207.1|	   688 residues, 50 /line  protein kinase-like [Oryza sativa (japonica cultivar-group)]
----------MDSPWSPA--YISPGHYGVHDPRDFP------------------------
-----------------------ISPRFQVGAEDFDE-----------------------
---RIPD-----DFVRHSPKYRHYEVHSPQ--------------H---VDNLVWLP----
-----------------------------------------PGAVIQQN--AGFPGNLGR
P-------------GN--FLDG--------------------------------------
----------S--------------------SMYDHC---RSPFHKGQG-----------
------------DPRYVDPR----------------------------------------
------------------------------------------------------------
-WR----PIQ-HFDQ----------------------------TSMTNEYSGHPTNS---
---CPDCNRPGERFV-LNQDVRLENGVYVKEQT-------GGHPPPMFYNESHSHDRAWH
AHA---NQSHQRYE--DP---------------RL-----HMP-----------------
------------------------------------------------------------
--------------------------------------------------GSARA-MEPY
IVDNSSV--TSLSRSSHESPHYFHGSSEHVSDTYHNQQVG-VGGPYVQTPGFEE------
----STG-QHYSH-SSTYGADPFYQMQQNLPPL-QSL----------RRRANSPVHTGSP
YESPHLPIPNGNFVRN---T--GDVSPRIPGMPAYD--------------RIPNPWPSPN
GSIPYRVVGHDIPAVVENRS---NPNSGQYVQPLFAPES------------VQNQPGAPL
ME------IHPERACGGSVLSSQVDGRVAA-----------LPLTDQLS--RMDINPLKK
------LEGPEHEKFTRNA-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------N--E-TTSLHAMNDPSALTHHI
GVVP--------------------------------------EVDPKQRKPVEYETVTSK
VHEGGATA------LQECGDISEDR-LNFL----------------------PELAASVK
KAALEDSEEKEKAQQD------------------------------------AGP-----
--------TLLPTCDEEGNGKKL----EETPAGNTGTD----------------QD-SD-
---------VHGSGEQQKSSGIEATTAEAEALSKGLQTIKNDDLEEIRELGSGTYGAVYH
-----------GKW------------------RGCDVAIKGGIVNNSLRPQIPSWCDP--
--EWKSLMENCWASEPADRPSFT----------------EI-------------------
-----------SQR--------------LRKMAAAMNV-K
>gi|68354644|ref|XP_695190.1|	   621 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
----------MDSADSII--V-RIKQGNRSIERYIK------------------------
-----------------------EFLELAPKSSHSDLLLMMFFRGGLLDPVRSLMPPYE-
------------------------------------------------------------
---------------------------------------------------EDWNLYRFI
E-------------AA--LLIAGSPLSVALREEN------------PQEGG---------
-------LSGG--------------------QQRGIF---SGPADLTKG-----------
------------KRREAGLE----------------------------------------
----------------------------------------------------LRP-YQRR
AVR----RSP-FSEP----------------------------LESLLELCGTPVSAP--
VPQCPPVSAPAPEQA-VNYALPSQTTRRRRR-----------------------------
----------------------------------------RNRTAPAPERPPVSAPAPER
P--------PV-SAPAPERPPVSAPAP--------------ERPPVSAP-----------
---------------------APERPP-VSAPAPERPPVSA-PAPERPPVSAPAP-ERST
MPVPVP-------------PLALPAPPRLLALPAPPRLLA-L-------PAPPR------
----LLA-LPAPP-RHLALLDPVRLQALPVSVR-LFALPTSLGLLVLPAPVQLPSVSPAP
VQLPPVPPA-----------------------PVQLPLVPPA----------PVQLPPVP
PAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPP--APAQ------LPPVPPA
PA------QLPPVPPAPAQLPPVPPAPAQL-----------PPVPPAPA--QLPPVPPAP
------AQLPPVPPAPAQL------------P----------PVPPAPAQLPPVPPAP--
----------AQLPPVPPAPAQL-------PPVPPASAQ-LPPV-PPAPAQLPP------
------------------------------------------------------------
---------------VPPALLKTPALCP--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------LRDHPWVIPPDP----PWWSFPLL-------------------------
----------------------------------------------GTDSPAAPWLPAGV
PDPQTDPDMTLPSL------------------PLFLLCS---------------------
-------------APPLGTSLGA----------------SGSRSLEG-------------
---------------------------------------G
>gi|71031766|ref|XP_765525.1|	   675 residues, 50 /line  hypothetical protein TP02_0958 [Theileria parva strain Muguga]
----------MEQTAYIY--TIVLLIVQLVEC----------------------------
------------------------------------------------------------
-----------------------------A--------------D---QPNQPPI-----
-----------------------------------------QPIYYLIP--TNESQQSQN
Q-------------LQ--NIQVQPVVYYVAGPEP------------TPQAI---------
-------NYYG--------------------PLPTQP---APV-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------QYYVPGPQAPQPV
QVQ---YD----------------------------------------------------
---------GI-LQQQMQI-----------------------------------------
---------------------DPVIQQ-LQYIQVPQPAPAI-------------------
LPQQMQQ--TFGPPQPIPI--RQYDPYQQYLQVQEPINYG-AQPVQQSQPQQIE------
----YIQ-GPHPT-PVALPQQQVHYGSVVPA-Q-PTQQPYGPFQPQH--QPQMPSGYQLP
PQNQPIPI-PPQNQPI---P--IPP-QSQPISMQQFVQGPRPIHPQPTPIQTQPIVHPRP
IHPQPTPIQ-----TQPIVHPRPIHP-----QPTPIPVQPM--QQKP--PTQFRP-----
----------PQPKIPVPSGPQQE----------------------NLY--LRGPQLPFP
------ELREPFRPEINKGPGLLGPAPGPLRH------------PIYVTQGITSREQP--
----------IKIPHTKHQTER---------PTKSQPTK-PEPS-KPTKPSEPT------
------------------------------------------------------------
----------------EPSGTDKELQPERIPVEVG-------------SDDETEEGAAGG
GDDD--------------------------------------DEGDEKVKPSEPVKKCEK
ITFMKRDN------SGKLVEMTDDE--YFI----------------------KWIVATKI
KYVFKAKLEAVLC---------------------------------------------DE
EVIFNQAPEKEYCKSMVYNIPYC----AFIFGRSDGYVLV-KYHKGSWKLKARGIP-DY-
---------VEL---YTVDEGGNDVKLGDEAYYLKFTPSASFKFSLIP------------
-----------SVR------------------LTKVVVKGETVWEKSCSD----------
-----------GFPISVSVTDRM----------------NVLMFFNQYIR---------I
YGPRRGKYRYLFTR--------------PNLESTK----H
>gi|92891422|gb|ABE90805.1|	   639 residues, 50 /line  Octicosapeptide/Phox/Bem1p [Medicago truncatula]
----------MDPPLIST---AATTIP--HNIIQQN------------------------
-----------------------YPESVESLSS---------------------------
------------PPPQPPPRSRVNETMNDD--------------S---FPNVPGG-----
-----------------------------------------KLRLMCSY--GGHIMPRPH
D-------------KS--LCYVGGDTRIVVVDRS------------SSLRD---------
-------LCSR--------------------LSRTIL---NGRPFTLKY-----------
------------QLPNEDLDNLITVTSDEDLDNM-----------------------IEE
YDRIASAS--------STM-KPSSSRLRVFLFFTKP-------DTTLSMGSLLDD-AKSE
TWF----VDA-LNNS----------------------------GILSR---GVSDSAG--
DSFVNLDSVPASDSS-NNLESQVESLTLLENNN-------NKVKNVLDNVNVVNSTPNSP
MLE---NSLSSSSL--TP---------------SM-----ENLPPIRVRVDENAGSRLQQ
E--------NK-VVMKQDGGFVVSSAN--------------VAMAAIPATSTMAFGGV--
-VTATSGDVNV-NRVVSDDERSDYGGL-IGSRKPPLPLQLV-QPRTSGGVSLPSP-DSVT
SDSSSIA--STNSFSKIIYHQEQVQGTNI------------------------E------
----NKP-QDSSY-MLPPQSDPNQQLQQ--------------------------------
------PPQQQQQFVH---P--NTHYIHHPTSTNQVPITSYYQVYPPPSQQSQLHHPQQY
PVYVMPIGSTQQPYNMTLQHNINDPNVVASSRPII--------------PQNGTPPIYPN
KA------PNPNVASNSTFVQVPSNQFQQQ-----------YV---GMP--QFHHQPQHP
------INVAP-PSGTNYGYEYSGNVEGQVY-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------YTQQQ
NNAPLVTQY---------------------------------------------------
---------------------------------QSMTPAAAAAALSDASQ--------QF
PGENVQQSNRTS------------------------------------------------
------------------------------------------------------------
---------QP----------------------------V
>gi|113415920|ref|XP_001128737.1|	   526 residues, 50 /line  PREDICTED: similar to gamma-aminobutyric acid (GABA-A) receptor, subunit epsilon [Homo sapiens]
----------MRFLECVS---AEGVNLELQLEVNVG------------------------
-----------------------LLNPLISSNHHSPPTRVRVSHSPPTTPRVSHSPPTPP
RVSHSPP-----TPVRVSH--SPPTPVRVS--------------H---SPPTPPR-----
-----------------------------------------VSHSPPTP--VRVSHSPPT
P-------------PR--VSHSPPTPVRVSHSPP------------TPVRA---------
-------SHSP--------------------PTPVRV---SHSPPI--------------
-------------------------PPRVSHSPP-----------------------TPV
RVSHSPPT--------PPR-V--SHSP----------------PTPVRVSHSP-------
------------------------------------------------------------
-------------------PTPPRVSHSPPTPV-------RVSHSPPTPPRVSHSPPTPV
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
RPQPTYT--SEGQPQPTYTTEGQPQPTHTSEGQPQPTHTT-EGQPQPTH-----------
--------------TSEGQPQPTHTIEGQPQP-------------TY--TTEGQPQP---
-------------------------------------THTSE-GQPQ-PSYTSEGQPQ--
--PTHTIEGQPQPTYTTEGQPQPTHTSEGQPQPSYTTEGQP--QPTH--TSEGQPQLTHT
TE------GQPQPTHTTEGQ----PQPTHT-----------SE----GE--PQP---THT
------SEGQPQP-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------THTSEGQPQPTYTTEGQ----PQPTY----------TSEGQPQPSYTS------
-------------------EGQPQPTHTGEGQ---------------------PQPTY-T
TEGQPQPTYTSEGQ------------------PQPSY-------------TSEGQPQP--
--THTTEG----QPQPTHTTEGQ----------------QGRRRLNGSSR--------CI
DGIRRVKGEGG----------------------------E
>gi|113416398|ref|XP_001131587.1|	   743 residues, 50 /line  PREDICTED: similar to gamma-aminobutyric acid  A receptor, epsilon [Homo sapiens]
----------MRFLECVS---AEGVNLELQLEVNVG------------------------
-----------------------LLKPLISSNHHSPPTRVRVSHSPPTTPRVSHSPPTPP
RVSHSPP-----TPVRVSH--SPPTPVRVS--------------H---SPPTPPR-----
-----------------------------------------VSHSPPTP--VRASHSPPT
P-------------VR--VSHSPPTPVRVSHSPP------------TPMRV---------
-------SHSP--------------------PTPPRV---SHSPPYTSE-----------
------------G---------QPQPTHTTEGQP-----------------------QPT
HTSEGQPQ--------PTY-T--TEGQ----------------PQPTHTTEGQPQ-PTHT
SEG---------------------------------------------------------
------------------QPQPTHTGEGQPQPS-------YTTEGEPQPTHTSEGQPQPS
YTT---EGEPQPTY--TS---------------EG-----QPQPTHTGEGQPQLTHTTEG
Q--------PQ-PTHITEGQPQ--------------------------LTYTSEG-----
---------------------QPQLTH-TTEGQPQPTHITE-GQPQ------PTH-TSEG
QPQHTYT--TEGQPQPTYTIEGQPQPTHTTEGQPQPTHTT-EGQPQPTH-----------
--------------TTEGQQQPTHTSEGQPQP-------------TY--TTEGQPQPTHT
TEGQPQPTHTSEGQPQ---P--THTIEGEPHEGQPQPTHTNE-GQPQ-PTYTTEGQPQ--
--PTYTSEGQPQPSYTTEGEPQPTYTSEGQPQPSYTTEGQP--QPTH--TSEGQPQLTQT
SE------GQPQPTYTSEGQ----PQPTHT-----------NE----GQ--PQP---TYT
------SEGQPQPTY------TIEGQPQPTYT----------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------SEGEPQPTHTTEGQPQPS---Y--T-TEGQPQPTHTSEG----
------------------------------------------------------------
-----------------------------Q----------------------PQLTHTS-
------------------------------------------------------------
EGQPQPTHTSEGQPQPTYTSEGQ----PQPTH----------TSEGEPQPTYTS------
-------------------EGQPQPTHTNEGQPQPTYTSEGQPQPTYTSE-GQPQPTY-T
TEGQPQPTHTSEGQ------------------PQPIY-------------TTEGQPQP--
--THTSEG----QPQPTHTTEGQ----------------QGRRRLNGSSR--------CI
DGIRRVKGEGG----------------------------E
>gi|113413027|ref|XP_001133384.1|	   707 residues, 50 /line  PREDICTED: hypothetical protein [Homo sapiens]
----------MPA-------------------KPAQ------------------------
-----------------------LEPAKPA-KPAKPAKPAS-QPSLQSQPASKASQVSLP
SQPRQPA-----SQASQASQGSQASSESQS--------------S---LPAKPAK-----
-----------------------------------------PSSQPSQP--ASQASQSTH
P-------------LK--LAKSPGQPSLPSQLAS------------PD-SQ---------
-------ASQP--------------------AKPAKP---ASQPSQPAS-----------
------------Q---------AS-------QST-----------------------KPL
KPAKSP------------------GQP----------------SQPSQPASKA-------
-------SPA-SQPA---------------------------------------------
----------------SQPSRPSQTASPASP----------ASQPAKPASQPSQPATQPS
QPP---SKASQETQ--AS---------------QQ-----SWPNPPSQSAKPAKPATQPS
Q--------PS-QPTSQTAQPDSQPRQ--------------PRDPSQPAKLANPA-----
---------------------KPVSQA-SQAGHPAKPAKPA-NQPDSPARQPAQA-AKTD
KPASQAS--QASQPAKTAKPVKPGKPASQPSQPTQPAKPA-KTASQPSR-----------
------P-SQPAK-QAMEARQPASQASQPSQ----PSQPSQPSQSAR--KASQACQPVKP
AKP-----------------------ASQPSQ-RRHPASQAS----------QATQPAKP
AKRPSNPSQPRHPASQASQDTQPAKPASQPAKPAKPPSQPS--QANN--P-----ASQAS
QA------TQPAKPAKPPSQ---PSRPSHS-----------AS----QA--SQP---AKP
------AKPLSQPRWPSHPVKPAKPARQPSQP----------SQPRPPASQERHASQA--
----------SQGAKPASKQSQ---------PAQPATQA-SQVS-QPAKPAKPA------
------------------------------------------------------------
---------------RQGSHASQPAKPAKPPSQPS---H--P-RQTASQPSQPT------
------------------------------------------SQASQAS-----------
------------------------H-QPSQ----------------------PSLPASRA
S-----------------------------------------------------------
-------------------------------------QPA-KPASQPNQPSQPA------
-------------------SHLSHPSNPASQASQATDPAKSAKPPSQPSQPSQPNQPASQ
ASQAIQPAKPA--------------------------------------------SQP--
--S---------------------------------------------------------
----------------------------------------
>gi|113429293|ref|XP_001129546.1|	   607 residues, 50 /line  PREDICTED: hypothetical protein [Homo sapiens]
----------MGSLQVSS---AGSI--TSDLTALSG------------------------
-----------------------SQASQAS-QASQPAKPVR-QPSQTSQAASQGS-----
---------------------------------------------------QPAK-----
-----------------------------------------PPSQPSQT--SQAASQGSQ
P-------------AK--PPSQPSQPSHPASQAS------------QA-SQ---------
-------PAKP--------------------AKPAKP---ASQLS---------------
------------------------------------------------------------
--------------------------------------------QPSQPASQA-------
-------SQP-AKPA---------------------------------------------
----------------SQLSRPSQSGSQANQAN-------QATQAAKP-AKPAKPASQPS
QPS---QPASQA----------------------------RQASHPAKTAKPAGPPSQPR
H--------PA-SQANQDTQPAKPAKP--------------ADQPSQ------PR-----
---------------------HPASQA-SQDTQPAKPAKPA-DQPSQPRH----------
-PASQAS--QDTQ------PAKPAKPASQTSQPSQPAKLA-SHPSQPSQRATQA------
----SQA-GQTPK-TAKPPSQPASQASQASQAR-KASLPSQPSQQAT--QASQAGQPPKP
AKP-----------------------P-------RQPASQAS----------QESQPAKP
AKPASHPSQPSQ---RANQASQLTSHLSQPSQPASQPSQPK--QPSP--A-----ASQAS
QA------SQPAQTAKPAS------QPSQR-----------SK----PA--SQP---AKP
------ASQISQPSRPSKPA----------------------SQPAKPASQNSQATQP--
----------AKPPKTASQPCQ---------PNQPASQA-TEAS-QATQPAKPA------
------------------------------------------------------------
---------------KPPSQPSQPAKPAKPPSQLS---H--Q-RHPASQPAKLA------
------------------------------------------NQPSQ-------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------PS-QPPAKPAKPAKPA------
-------------------SQPSQPSQPASQASQATQPAMPAKPPSHPSQPSHPASQGSQ
DSQAIQPAKPA--------------------------------------------GQP--
--S---------------------------------------------------------
----------------------------------------
>gi|15242462|ref|NP_196524.1|	   531 residues, 50 /line  octicosapeptide/Phox/Bem1p (PB1) domain-containing protein [Arabidopsis thaliana]
----------MDKFSY--------------------------------------------
------------------------------------------------------------
--------NSYPDSAESSPRSRDVEFEN--------------------------------
-----------------------------PSPWEDQQQQNYKVKLMCSY--GGKIQPRPH
D-------------NQ--LTYVNGDTKIMSVDRG------------IRFPA---------
-------LVSK--------------------LSAVCSGGGDGGEISFKY-----------
------------QLPGEDLDALISVTNDEDLEHM-----------------------MHE
YDRLLRLS-------------TKPARMRLFLFPSSP--------ISGGFGS--EGSTKSD
RDTLNPIPS---------------------------------RPESEK------------
-------------------------SVTAPPNNADFLFGSEKVAPIPP-------SPVKV
PQPVPEPVVLEPPQMFVDQRMLQPEHGVNPAEI---QRQIQEFQMIQIRDQEQQMLHQNQ
LHQQQQQQE---------------------------------------------------
------------------------------------------------------------
---------AIHQNQLHHQQEVIHQNQLLQQEAIHQNQMLQQQQQQEAMYRRKTEDEAGR
YFPPTYTQNP---APVTNQQPPVGYWQ---GNTNNSNIQGNIYTTTS-QNLPEQ------
------------------------------------------------------------
----------------QQQQQQVYMIPAQSQAPGTLYQSVM-------------------
---------RPTVQGNQGYYPSPVQRLHHPDAY-----MEQQNQPG-----YNVVQPQPT
FSGGPQVMTSVGPQVMTSVGPPMGLQEPYSQMGKPVYYTVAGEGMMVQP-----------
---------------------PPAQPQQQQQQYQGMGQP---------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------VSGMTDLRTGPDGKVAVNMAAPQVSDSV
>gi|1754989|gb|AAB68048.1|	   894 residues, 50 /line  proline-rich protein PRP2 precursor [Lupinus luteus]
----------MPSLHSLIFLLLLGVVITPPVLANYKQP----------------------
--------------------------------TYEPPTPIFEPPPFETLPPVYEPPPVYH
PPREKPSIENPPPSYEKPPPHEKPPHEK--------------------------------
-----------------------------SPPEYSPPHEEPTPEFPPSHEKSPPLYPSPH
E-------------KPPIECPPPHDKLPPIYEPP------------NEKPPPLHPPPHEK
PPIDYPPPHEK--------------------PSPVYEPPYEKPPILHPPPHEKPPPLYES
PSEKPPHVHPPPPHKKPPIGYPPSYEKPPPVYEP-----------------------PYE
KSP--PVH-------------QPPYETPPIENPPHE--------KPPIHES--P--YEKP
PPVHPPPHD---------------------------------KPSIEY------------
-------------------------PPPHEKPP---VYEPPYDKPPPVHPPPHEKPPIEY
PPPHEKPPVHEPPYEKPPP-EHSPPHDKPPIEY---HPPHEKPPIEYPPPHEKPPIEYPP
PHEKPPIEYPPPHEKPSIEYPPPHEKSPVYEPPY-------EKSPPVHPPPDEKPPIEYP
P----------------PHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSP
PVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTKPPI
EYPPPHVKPP-IQYPPPHEKPPIEYPL---PHEKPPVYEPPYEKPPPVHPPPHEKPPIEY
SPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEK
PPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPP
PHDKPPIE-YPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPH-----EKSPMHEPP
YEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTH---------
-------EKPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEK--------------------
------------------------------------------------------------
------------------------------------------------------------
----PPHHEKRSALYPPHHRKPPNHHKPLPYKKPPFY-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------KSHQWKSHQATSPNLMPSSTSFQKND-E


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.