FANDOM


In the plant Arabidopsis thaliana, At2g01190.1 is a gene model for the locus At2g01190.[1]

This gene model is classified by TAIR as "octicosapeptide/Phox/Bem1p (PB1) domain-containing protein". It is located on chr2, region 115022-117295 FORWARD.

Physiological functionEdit

At2g01190.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g01190.1/Expression

Subcellular localizationEdit

At2g01190.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g01190.1 has 720 amino-acid residues and a molecular weight Mw = 77.317 kDa.

The protein is relatively acidic; at the physiological pH 7.4, its net charge is -16.67, or -0.023 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g01190.1/Knockout

Protein interactionsEdit

At2g01190.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g01190.1 has 1 recognized domains:

  • Domain_0089_0181 PB1 domain (PF00564, IPR000270) Description: Octicosapeptide/Phox/Bem1p_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g01190.1
MEPPPSSLSS TAVASTSISA ATAPVPPPLP PHVTSSYPES LDSSPRSRTT DGWDDLPAPS GGGGGGGGSA VSSKLRFMCS YGGHILPRPH DKSLCYMGGD TRIVVVDRNS SLPSLIARLS NTLLDGRSFT LKYQLPSEDL DSLISVTTDE DLDNMIEEYD RTISASNSTK PSRLRLFLFT SKPEATQSMG QILESSAKSD DWFLNALNSA GLLNRGFSDS DTNVNRLLGL DDALALRSNS GDNNNRDGDD GSVKSAKQQQ PPPPQQQEQQ QGGQDVNCLP DSPMLDTSSS FGSTSSSPSL ANLPPIRVHV EEPGGVRTLP DQRNLGIEEQ FARFNVGNKH QLHDDGFAAI SSPPPMPVTI ALPAAPVTAA TVSNEFQARV YSDDERSDHG VQAGYRKPPT PRSQPQNLPP QQAHQLKSNS GGGHELPSPN SVSSDSSMSN PMFHQRPSVY QEPIAQIPSG STVVTGMINP SDPSTLLSQH QNQDPAYILH PQFEQQSAQS QPQQQFIHTA APPQYIHHHP SSGLPVPTYI QVYPSQQPQQ SFHQHAGRLD QQPYPVYYVT APVPPRPYSM PVPQSPSVSD AAGSIPSNHP NSTMMPPPPN NHMRSVSSGK PEMGQAGVYT TAPGVGGAQM VHQIPTNQQQ FMGYSQIRHP PQSGSAGNPN YGYEYVDNAH TQIYYTQPMG HAQYQTMTGP PPAMVMPDGS AAAKLPAENM TQQIRSSQPL
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.