Fandom

Proteins Wiki

At2g01180.2/PDB

< At2g01180.2

47,923pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g01180-2_2a96_A.pir.txt

======================================================

Assigned types to 327 residues in Sequence 2-01180-2, 0 remain unknown
Assigned types to 137 residues in Sequence 2a96_A, 190 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file At2g01180-2_2a96_A.pir.txt into sequence alignment.

======================================================

>2A96.pdb  Made from 6960 ATOM records in 2A96.pdb
QPFHSPEESVNSQFYLPPPPGNDDPAFRYDKEAYFKGYAIKGSPRWKQAA
EDADISVENIARIFSPVVGAKISPKDTPETWNMLQNLLKVGGYYATASAK
KYYMRTRPFVLFNHSTCRPEDENTLRKDGSYPSGHTAYSTLLALVLSQAR
PERAQELARRGWEFGQSRVICGAHWQSDVDAGRYVGAVEFARLQTIPAFQ
KSLAKVREELNDKNNLLMQPFHSPEESVNSQFYLPPPPGNDDPAFRYDKE
AYFKGYAIKGSPRWKQAAEDADISVENIARIFSPVVGAKISPKDTPETWN
MLQNLLKVGGYYATASAKKYYMRTRPFVLFNHSTCRPEDENTLRKDGSYP
SGHTAYSTLLALVLSQARPERAQELARRGWEFGQSRVICGAHWQSDVDAG
RYVGAVEFARLQTIPAFQKSLAKVREELNDKNNLLSQPFHSPEESVNSQF
YLPPPPGNDDPAFRYDKEAYFKGYAIKGSPRWKQAAEDADISVENIARIF
SPVVGAKISPKDTPETWNMLQNLLKVGGYYATASAKKYYMRTRPFVLFNH
STCRPEDENTLRKDGSYPSGHTAYSTLLALVLSQARPERAQELARRGWEF
GQSRVICGAHWQSDVDAGRYVGAVEFARLQTIPAFQKSLAKVREELNDKN
NLLMQPFHSPEESVNSQFYLPPPPGNDDPAFRYDKEAYFKGYAIKGSPRW
KQAAEDADISVENIARIFSPVVGAKISPKDTPETWNMLQNLLKVGGYYAT
ASAKKYYMRTRPFVLFNHSTCRPEDENTLRKDGSYPSGHTAYSTLLALVL
SQARPERAQELARRGWEFGQSRVICGAHWQSDVDAGRYVGAVEFARLQTI
PAFQKSLAKVREELNDKNNLLS

======================================================

Best alignment:
2A96.pdb    130  SYPSGHTAYS----TLLALVLS   147
                 S+PSGHT++S    T L+L LS
2-01180-2   186  SFPSGHTSWSFAGLTFLSLYLS   207

======================================================

Highlighted IDENTICAL residue SER  153  index1  130  path  186  %Seq 100.00
Highlighted IDENTICAL residue PRO  155  index1  132  path  188  %Seq 100.00
Highlighted IDENTICAL residue SER  156  index1  133  path  189  %Seq 100.00
Highlighted IDENTICAL residue GLY  157  index1  134  path  190  %Seq 100.00
Highlighted IDENTICAL residue HIS  158  index1  135  path  191  %Seq 100.00
Highlighted IDENTICAL residue THR  159  index1  136  path  192  %Seq 100.00
Highlighted IDENTICAL residue SER  162  index1  139  path  195  %Seq 100.00
Highlighted IDENTICAL residue LEU  165  index1  142  path  202  %Seq 100.00
Highlighted IDENTICAL residue ALA  166  index1  143  path  203  %Seq 100.00
Highlighted 9 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g01180-2_2a96_A.pir.txt.2A96.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g01180-2_2a96_A.pir.txt PIR amino_acid 2A96.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.