FANDOM


>gi|42570631|ref|NP_973389.1|	   302 residues, 50 /line  ATPAP1 (PHOSPHATIDIC ACID PHOSPHATASE 1); phosphatidate phosphatase [Arabidopsis thaliana]
MQEID----------LSVH-----------------------------------------
-----------------TIKSHGGR-VASKHKHDWIILVILIAI-EI-------GLNLIS
PFYR-YVGKDMM-----TDLK-----YPFKD-----NTVPIWSVPVYAVLLPIIVFVCFY
L-----------------------------------------------------------
---------KRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPDGKEL
YD--------------AL---GGVVCH-GKA-----AEVKEGHKSFPSGHTSWSFAGLTF
LSLYLSGKIKAFN-----------------------NE------GHVAKLCL-VIFPLLA
ACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHE----EGWGPYAYFKAA
Q-------------------------------------ERGVPVTSSQNGDALRAMS---
--------------------LQMDSTSLE-------------------------------
------------------------------NMESGTSTAP-R
>gi|108881118|gb|EAT45343.1|	   306 residues, 50 /line  phosphatidic acid phosphatase [Aedes aegypti]
MNKNGSVTTP--------------------------------------------------
-ATPVSKSTSIN--------GNGVASANINLFQEIVIRLMLFGL-YF-------YFELKE
AFVR-VIHPEEM------WLYK----NPIS-----PSYVPLALLYPAVFGLVGLVIIGYF
I-----------------------------------------------------------
---------RSRDFQDFKCAWLGFSLACTLNGAITDVIKVSVGRPRPDFFYRCFPDGQMN
ED---------------------MACT-G-----DAWTVKDGRKSFPSGHSSFAFAALGY
LAWYLFAKLHVFT-----------------------ERG----RGQTWRLLA-SGGPLFA
ALMVAISRTCDYHHHWQDVTVGSLIGLTVGYLSYRQYYPPLDSR----HCYLPYSSEV--
-------------------------------------------ISPNSNRKSVSKRDQVP
-----------------DESESDTKMLL--------------------------------
-------------------------------GGEEKESKW-T
>gi|111069427|gb|EAT90547.1|	   370 residues, 50 /line  hypothetical protein SNOG_02335 [Phaeosphaeria nodorum SN15]
MPSTSDAA------------------KPAASSAELAHVTSRQPQSTSNRSTSPSSLKHDL
ESANPNPSHYNHWLPGFHNPPLFLT-FLRHNWYDIGTQLLCLLTSLLLYAFCQPILPRYF
PLFR-GVERTSWGM----KHS-----QPYLS-----EYVSTITSAIISFAVPAAIMGAIA
LWG---------------------------------------------------------
----------TRGFGDGNAALIGLGYALSTATLFQSFIKIFIGGLRPHFLTICNPRIPPS
LPGLS---TLRDGDLHF--YTASQVCR-G-----DANKVREAQMSFPSGHSCAAFAGFGF
LALYLNAKFKVLS-RGGHFRDYYGDKAWERSERSE--RGDGMERVHHWKLVL-FVAPWCI
AILFALSKIRDAWHHPVDVVFGALVGTLFAHMAYKMAYRSVYDS---RTNHIPLEGD---
------------------------------------------------------------
------------------------------------------------------------
-----------------------------GGDFNKEEVKD-K
>gi|115629247|ref|XP_787511.2|	   258 residues, 50 /line  PREDICTED: similar to Phosphatidic acid phosphatase type 2 domain containing 1A [Strongylocentrotus purpuratus]
------------------------------------------------------------
------------------------------MILELLVRIFLLIA-FL-------ITEELD
PFQR-VIQPEEM------WLYK----NPHSVHST----VTTRMLFSSAILVPLCVITIFS
L-----------------------------------------------------------
---------MRKDRLDFLHAVLDLDLS---------LYHCIVKKPRPDFFYRCFPNGVMT
T---------------------DLKCT-G-----DLDTINEGRKSFPSGHSSFSFCAFGF
TAFYLAGKLHTFE-----------------------SRG----RGVGWRILV-TLAPLYV
ALMVALSRTADYRHHYEDVIAGSLLGLAVAYAIYRQYFPALTHA----TCDKSYARLYAL
RD----------------------------------------------------------
---------AMSLQEYNTNNAISTRIPL--------------------------------
------------------------------------DSVKTV
>gi|116056575|emb|CAL52864.1|	   291 residues, 50 /line  putative phosphatidic acid phosphatase (ISS) [Ostreococcus tauri]
MASSSGERGE-------------------------------------------------T
AREAREEREETSN------LMTRRA-RARTLAVDAVAFGLMFSL-GT-------WLEVAE
PNQK-YIQQ-----EMLWRYS-----YPHKE-----NTVPTVVVPIISFLIPLACMLAVP
R-----------------------------------------------------------
---------SWNPHVRKERAIGGLTVSVGLTWVVTCAMKNIIGNIRPDFVARCWPDGNIV
WAS-----------------AGVPKCS-GAN-----DDVQQGRRSFPSGHTSMSFSGLFY
CSLYLAAWFRVGR-----------------------EERKFRRWEAVWKLIV-VLGPTLL
AMFVGLTRIRDYWHHWEDVLVGATLGTTFAYVSWVYKKPYVRPSGFGFN-----------
------------------------------------------------------------
------------------------------------------------------------
---ENYTPLGRSAEDF----------------------SLVD
>gi|116505206|gb|EAU88101.1|	   260 residues, 50 /line  hypothetical protein CC1G_11524 [Coprinopsis cinerea okayama7#130]
MEK-------------------GPAEMPSRDHEPAASVSSQQPLAQQPRAQQ--------
-----------------TQAFNLVV-WLKLHGVDIITMACMGAV-AL---G---VHLAPA
PSNDFPIYNVDG------SIM-----YPEYSFPRKTQIVPIWASALMAIFIPLVFFVLAQ
A-----------------------------------------------------------
---------RRQSVDDLLTTFLGLIKSVVSSSVFQVIIKATIGGLRPHFYDVCKPLVSPG
DAPS------GIGFNDII--YDPSICT-G-----DSEHIKDALRTMPSGHSAAAWSGLMF
LAFYLNAQLKVIS-----------------------GN-----NPAYWKSVL-FLAPILG
AFLLSAYL----------ITIGQ-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------T
>gi|118793866|ref|XP_321121.3|	   249 residues, 50 /line  ENSANGP00000019070 [Anopheles gambiae str. PEST]
MSGVAYACGGTTGQ----------------------------------------------
-------------------KKLPRA-PEYNLPLETVVRIALTCI-YI-------ALEFKA
PFVR-KIQPEEL------WLYR----NPRTD-----SYVPLTMLWPIVLGVPGLAFTLHY
L-----------------------------------------------------------
---------RTRDRQELRCTVLAFTLGLGLNGVITNTVKIAVGRPRPDFFWRCFPDGVLN
---------------------DELHCT-GK----DMRALIDGRKSFPSGHSSFAFVGLGF
LTWYLIGKLHLMN-----------------------ERG----RGRSVRVIA-AGLPLFA
ATMIAISRTCDYHHHWQDVTVGSLIGIVLSYLCYRQYFPAF-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>gi|119194029|ref|XP_001247618.1|	   265 residues, 50 /line  hypothetical protein CIMG_01389 [Coccidioides immitis RS]
MAQNDLPLH------------------------------------------------GNR
KPSGISARP-------GCLGAVARF-WYRSYAADYISLAIITAG-WF---I---IQIFVE
PFHR-MFSLENG------SIQ-----FPFAVVER----V---------------------
------------------------------------------------------------
---------------------------------PVDVVKNAVGRPRPDLISRCKPEKG--
------------TPAHTLV--SFNVCL-ET----DHHILHEGWRSFPSGHSSFAFGGLGY
LSLFFAGQLHVFR-----------------------------PRSGLARFLF-SGAPLLG
ALMIAMSRLADYRHDVYDVTVGSLLGLFTAYFTYRRYYPSLKSI----DCDTPYSRPSGG
------------------------------------------YVAVSGVNRGLGDEEQPC
----------------NSPRPEYSGAEY--------------------------------
---------------------------------QM------Q
>gi|121699191|ref|XP_001267939.1|	   309 residues, 50 /line  PAP2 domain protein [Aspergillus clavatus NRRL 1]
MPRNGSA-----------------------------------------------------
----TGPKPT------GVPGILARFYQRSYPAVDYVALACLAGI-WV---M---IQLFVD
PFHR-MFSLDNR------SIQ-----YPFAVVER----VPVLWSIIYAGLIPLLVIICWA
AVF---------------------------------------------------------
----------RPKPYQVQLTVLGLLVALMLTSLITDIIKNAVGRPRPDLVSRCVPKKG--
------------TPGNALV--AWTVCT-QT----NNHILQEGWRSFPSGHSSFSFAGLGY
LSMFFSGQMHVFR-----------------------------PRADLWRCIL-ALIPMLG
ALMIAISRLEDYRHDVYDVTCGSLLGLVVAHFSYRRYYPALRSA----ACDTPHDFTDS-
-------------------------------------------PGPNGFSKLPADEEQQI
----------------HGRSWEAETYPL--------------------------------
---------------------------------EELPPHNGR
>gi|123471801|ref|XP_001319098.1|	   253 residues, 50 /line  PAP2 superfamily protein [Trichomonas vaginalis G3]
MIEIDE------------------------------------------------------
-------RDPLWKRIL-----------YFIDYQDMIISILALAV-WL-------GLSTIE
PNYL-YIPENDG------DSN-----YPMKK-----SQIPFLLLSFIVFGGFNLIFIGLY
FLAR------RYPK----------------------------------------------
----------YFCRFDLFPVAWGLVFAISMSNIFVNVPKSYVGRARPDIYARCGVK----
---------------------NLTECP--------QKILKEEHKSWPSGHSSTAMSATIY
MAAFFIKFLYA----------------------------------KPYAIIF-SALFALF
GIYVGATRIVDFRHHPDDVLAGLFIGFIAAYIVWENLSTKIFIESNQK------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------DETLPLPQTITQ
>gi|123503270|ref|XP_001328470.1|	   250 residues, 50 /line  PAP2 superfamily protein [Trichomonas vaginalis G3]
------MKLFKTLGS---------------------------------------------
-----------------EFTYFWKS-FL-ENLPEWFATICLGLVSV----V---IALMIE
PKER-IAFFENF------NER-----YPYSG-----ETLGIPIVALLIIILPCAVLGILT
LAY---------------------------------------------------------
-----------PRRMELNLAGMSLAQSLCLTLLITEALKVTVARPRPNFFSYCQYDQNA-
-----------------------KKCT-GPS-----SHKRDARLSFPSGHASNAFATGTW
MCLFLGEFFH--------------------------------NSEEIWWIIL-RFIPIMI
ATFIAATRITDYMHHVSDVISGVVIGIGCSTIIFRAQSNRIFMTNHRR------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EEPVSLL
>gi|125828555|ref|XP_697507.2|	   303 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
MEVG--------------------------------------------------------
-ASSKWVGHELQKVMQLYWGKYSTL-LTFVLFLSLL-FLLVGLPFA----I---LTIQHK
SFKR-GFFCNDD------SIK-----YPYKE-----DTISYQLLGGVMIPVTLLTMIIGE
CLS-------VYLNRIKSN-----------------------------------------
-------SFCNGYVACVYKAIGTFVFGAAISQSLTDIAKYSIGRLRPHFLDVCKPDWSKI
NCTA-----------GAY--IEDFVCT-GKE-----SVVNEGRLSFYSGHSSFSMYCMLF
LALYLQARMQA-------------------------------EWARLLRPTL-QFFLIAA
SVYTGLSRVSDYKHHWSDVLTGLIQGAIVALLVVFF-VSDFFKKKVEPQKETEIPH----
------------------------------------------------------------
------------------------------------------------------------
------------------------TTLQETPTNGNHYDNP-N
>gi|126137015|ref|XP_001385031.1|	   361 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Pichia stipitis CBS 6054]
MDIHDWS-----------------------------------------------------
--------------FSYMKHDISGL-SFLSYVVDWIVYVAILTV-AI---L---FGSVIP
PWYH-EFLTNDI------SLM-----YSHVSEED--TVIPINILLVITVVLPLLQFVLCA
LYS-------PSS-----------------------------------------------
---------GTRRAWDIFAGLTCLCGSMATQLMITCVLKNICGLPRPDLLSRCQADIDLV
-------------PDEGLL--TVAVCT-ND----NIFLLQEGFRSFPSGHLSTVFCGMVV
TSLNIAGKFQVFD-----------------------------KRAMSTKIFL-TIVPIIV
ACFVACTRISDNRHFLRDVVGGAIIGSSAAVWFYSQCFPSVFHL----ENAGRA--YPPR
RFGVA-------------AFFNNVGGFW----------ALREKIPGSFMDRILNTRSTLE
LLKNSDPIVNGEIDNPDELVNIQSNIR-----------FLNRIAPIFKNRTLNLNTKQ--
-------------------------------------EETSV
>gi|145231560|ref|XP_001399257.1|	   348 residues, 50 /line  hypothetical protein An02g01180 [Aspergillus niger]
------------------------------------------------------------
-------------MLSTQPRRTSKR-VIASYLLDWAFIIILVVT-GG-------ILYKIT
GSEH-VFSLDDA------NIS-----YPLKS-----DTVSITTVGIVCCVVPALLIAAIC
LLT-------PLPW----------------------------------------------
----------HRRLWEWHAGWLGLALSLAGAFFLTSGLKDVVGKPRPDLLARCQPDLTNL
TTYAVGGLGLQRAESPVMV--TSAICQ-NP----DATVIKAGFAAFPSGHSSFSWAGLLY
LSLWMGAKFAVSVPVRSTA--LSAAGRDKKTDSSFSRASAI-AAPPLYLLVL-IAIPVGG
ALYICASRYMDYMHAGWDILGGSLIGIVFAILGFMWYHAPAGLA----YGGWAWGSRQ--
--------------------------------------SDGAFGAGFGDGLCAGSGSRNK
-------------------EGSRDGYQDLELGAM--------------------------
-------------------------------HASQGVIRD-A
>gi|145257482|ref|XP_001401753.1|	   298 residues, 50 /line  hypothetical protein An04g03870 [Aspergillus niger]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------MLVESPGLTSLIGVSLAQEVRTR--------YPDCR--
------------TPLSVLA--NMHLSK-TA----SDHGLQVGQR------FKTSFAGLFY
LTLWLSGKLHIMD-----------------------NR------GEAWKTLL-VMIPSLA
ATLVAVSRIMDARHHPFDVITGSLLGIICACISYRQYFPSLNEP---WKKGRAY---PIR
TWGRDPVGPVETVRLVGTDGSTAALRNPEEERLNEAPQ---SKTTGSDAGRPLYLPESNP
YT-----TNMYGYSRRDEDDNWSSSSEDVAGGYEMQPGYARTQNPALNGPTARLDVDTAY
HSQTPQVVLGAATTHETPGAIPTHADRGRDLTDMPYRE---V
>gi|146415899|ref|XP_001483919.1|	   243 residues, 50 /line  hypothetical protein PGUG_03300 [Pichia guilliermondii ATCC 6260]
------------------------------------------------------------
---------------------------MSKFNAEWLVVVGLLLYFY----L---VAEPSK
PFVR-PFRLSDP------SIQ-----FPFATHER----VTDNQLYVISCILPSLAITAWC
TAL------LKRKKL---------------------------------------------
--------TKFQFQQLVNTSLQNLWLSISITGVITDVLKAWIARHRPDFLERCGPIVG--
------------TPIDKLV--GIEVCS-APL---GQIYLVDGMKSTPSGHSLIAFAGLFY
FSLWIYSRIGHLS---------------------------------IGYQLS-SCLPSLL
ATYIALSRTQDYRHHYSDIIIGSAMGIAIATITFFRKEK--------DKTELP-------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------L
>gi|146420035|ref|XP_001485976.1|	   348 residues, 50 /line  hypothetical protein PGUG_01647 [Pichia guilliermondii ATCC 6260]
MISLQGLYADRPLGK---------------------------------------------
-------------------LPISLY-TATSCGLDWFLYLFFATI-SI---T---LGVLTL
P-SH-EYAVQDL------RLQ-----YSYTPNET----FPIWQLVFITIVCPPILFFAIS
CLD-------FRRV----------------------------------------------
--------TIFRILWDTFAGLTALCGSMATQILIVCVLKNTLGLPRPDFLDRCQPSIE--
------------FGMG-----TIADCT-ST----DDGILREGFRTFPSGHSSTAFTAMTM
VSLFSAGKLQVFD-----------------------------NRGVSIKIAL-VVAPMIL
ASTIASSRIADNRHFLSDTLAGAAIGIFCAYWFYRQYFPSVLLL----TNKGRA--YPPR
RNGVS-------------HLFGNVGGFW----------FIEESDNGQYCKRCLNRPSTCK
KL-----VQLGIVDHDTHAVSVGSSLEA-ASKA---------------------------
KAQL------------------------GHTVN----LDTPL
>gi|146453151|gb|EDK47407.1|	   304 residues, 50 /line  hypothetical protein LELG_05588 [Lodderomyces elongisporus NRRL YB-4239]
MSMEGLL---------------------------------------------------NN
LPSPQFNRANLG--------FIPRR-IVKWRVTDLALLAVLVIS-YF-------FIYRIK
PFHR-QFYINDI------TLQ-----HPFAERET----VNNLELFIYSTWVPLVIALITS
LIL-------TKP-----------------------------------------------
----------KYKVYNTYVACLGLLLAVLVTSNVTDILKNLIGRHRPDFLSRCKPDPS--
------------TPKDVLV--SIEVCT-SK----DTGLLEDGYRTTPSGHSSIGFAGLVY
LALFLMGQFQANS-----------------------TR------VGSWRTLLCGFTPLLV
ASFIALSRTEDYRHHFVDVFIGSMLGLVIGSWSYLRLFPWISNP----QSYSNLIMI---
------------------------------------------------------AEEEED
-----------AENRHKVGDVVI-------------------------------------
-------------------------------DGEADTMLEDV
>gi|19112260|ref|NP_595468.1|	   279 residues, 50 /line  phosphatidic acid phosphatase [Schizosaccharomyces pombe 972h-]
MEAVG-------------------------------------------------------
---------------------KHVK-LFWNVYSDYAVLIAISLS-YF---V---FDVLML
PFTR-QFSLEDI------TIS-----HPFALHEQ----VPTKYLGIICVFFPALVLYGFG
K-----------------------------------------------------------
---------LRNNSLLFWKSLMGLLYSTMVCGLCVSLLKNAVGRPRPDFLARCQPFES--
------------TPKTGLV--DVLSCS-VP---WSDKVLQDGFRSFPSGHTSFSFAGLGF
LAIFLAGQLKMFR-----------------------------NKTSSWKVVV-PLVPLSI
ASWIGLSRSQDYRHHKEDIAVGALFGFAIAYVVYRQLFPPLDHH----NADILYVQAELD
----------------------------------------------------------EG
-----------YTNVHSA------------------------------------------
------------------------------GNSSATNAEQMV
>gi|24652084|ref|NP_724787.1|	   379 residues, 50 /line  wunen CG8804-PB, isoform B [Drosophila melanogaster]
MPAVKIIMSTETSASETTPLRRSENETPDHKELAQSNSNSRQTTVNSNNNNYSNSVQVRL
QEQDRDSDSEQQQHTATITMDTNKR-ILCRVGLDVLILLCAGFPIL----L---FFLLGE
PYKR-GFFCDDE------SLK-----HPFHD-----STVRNWMLYFIGAVIPVGVIFIVE
VII-------SQNKAKQD--NGNATSRRYVFMN---------------------------
-------YELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMAD-
-----GSTCDDAINAGKY--IQEFTCK-GVG--SSARMLKEMRLSFPSGHSSFTFFAMVY
LALYLQARMTW-------------------------------RGSKLLRHLL-QFLFIMV
AWYTALSRVSDYKHHWSDVLAGSLIGSISALVVAN-YVSDLFQK----PNTKPYLARTV-
------------------------------------------------------------
------------------------------------------------------------
QDMN------------------------ASPAQAITITT--N
>gi|24668567|ref|NP_649391.1|	   334 residues, 50 /line  CG11440-PA [Drosophila melanogaster]
------------------------------------------------------------
----------------------------------------------------------MH
TFKR-GFFCSDL------SIR-----YPYKD-----CTITVPMLLLMMLLLPMLFVAVVE
IMR-------ICKRFRTR------------------------------------------
-----------LYFRNLWRAEATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDD-
-----GSSCSDLQNAELY--VEQFHCT-NNNL--STRQIRELHVSFPSAHSSLSFYSMVL
LALYVHGVWRGRG------------------------------GVRVLRHVL-QFLLLMA
ALCVSLSRVADYWHHWSDVLAGALLGVTYAAITAAYVGNLLRRQ----TSSTGRI-PPSL
NYSHH----LHHQLMADNNNSTASAKVHFLAAAASASMTTTTPLDDIQDSDVEDSRDCRD
-----------SEDSHDSQDSHAENEDDNEEVY---------------------------
KSQM------------------------SRPVTPPTDLTHVV
>gi|24668581|ref|NP_649395.1|	   305 residues, 50 /line  CG11425-PA [Drosophila melanogaster]
------------------------------------------------------------
-----------------MSFNLSLR-PPIRLLVDLVLLGLLIVLVEN---F---RRLWGP
PTKR-GFFCDDE------SLM-----YPYHE-----NTVSPTLLHWLGLYLPLISLVVLE
SFL-------SHRKD---------------------------------------------
-------MAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPD-
-----GSSCLDESHRGALKYHTDYECR-PNLSQATEEMIRDVNVSFPSGHSAMAFYGLVF
VALHLRRRRWPL-------------------------------RGSLLSPVL-QLACVAL
AWFVAISRVIDYKHHWSDVAAGSLLGAGSALAVTRAAASEELQW----RCQDSLASAKQ-
--------------------------------------------------------EAAV
------------VDVADVKGGQQMPHDL--------------------------------
--------------------------------SLVTCHIS-N
>gi|28571517|ref|NP_730949.2|	   363 residues, 50 /line  CG12746-PB, isoform B [Drosophila melanogaster]
MTASK----------EGQESRRTLSDSS-AEDVRNTGSRTR--TNDDEMWRNELAMNTDS
S------SVQPEKREERSHRTGNSN-AKLSDAVDVVLRVLLVIT-FF-------KLETMT
AFKR-EIHEEEL------WLYK----NPRR-PDI----VRGGELLFWVIVAPFLVTIAFY
W-----------------------------------------------------------
---------YTRDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMV
LNTTSNG-------VDTSI--LDFNCT-GLP-----GDINEGRKSFPSGHSSFAFASFGF
IAYYIGAKLHAFD-----------------------SRG----RGHTWRLCI-AVIPLFI
ALLVAVSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYPSIFCP----DAGIPLVRWP--
---SR-------------EGSQYQ-----------------RLSGKDDNGSRG-------
------------PHHLDGGDAVRRPLLA--------------------------------
---------------------------------DKEESKW-Y
>gi|33589398|gb|AAQ22466.1|	   340 residues, 50 /line  RE35738p [Drosophila melanogaster]
MRDAP----------ED--------------QSVTVS---------MPASASGSAAG--S
T------G-----------PSSDRR-MTQRLLVELLVVVVLVIP-IC---V---YEFAVD
PVRR-GFFCDDE------SIS-----YPFQD-----NTITPVMLGLIVGLLPALVMVVVE
YVS-------HLRAGD--------ISATVDLLG---------------------------
-------WRVSTWYVELGRQSTHFCFGLLLTFDATEVGKYTIGRLRPHFLAVCQPQIAD-
-----GSMCSDPVNLHRYM--ENYDCA-GEGF--TVEDVRQARLSFPSGHSSLAFYAMIY
VALYLQRKITW-------------------------------RGSKLSRHFV-QFAVVMV
AWYTALSRVMDHWHHWSDVLSGSLLGVAGALITAHYIARMFDDG---A-SNIL-------
----------------------------SGGLRRE---NTAATLQE------------EV
------------CPTTPPPYSVNNSFS---------------------------------
---------------------------------EDQYCSK-V
>gi|45184740|ref|NP_982458.1|	   338 residues, 50 /line  AAL084Wp [Ashbya gossypii ATCC 10895]
--MHS----------EGIYFR--LGTKD-HDQSLEGYAAPK--LPYTLHGESKMAVD--R
V------TLSIP------KFKKQDL-LEKWRFTDVLFCIALVGA-NV-------GVYFAK
PFER-QFTINDI------TLS-----HPFAQVQR----VNDAMLVVYSFVVPLAVIIVVS
LLF-------ADP-----------------------------------------------
----------SHRYYLLYISVLGLFLSFLSDMIITNYIKNWIGRCRPDFLERCMPREG--
------------LEKDVLY--GIEVCT-TT----DTDRLLEGFRTTPSGHSSESFAGLGY
LFLWLSGQLLTES-----------------------------PAVGAWRKAV-AFIPLMA
AAVIALSRTQDYRHHFVDVILGSILGMWIAWWSYRRNFPAIQSY----VPFKPLLDNSDV
G-----------------------------------------LLNAPMLPRSVDEEM---
------------------APLNTPSVQS--------------------------------
----------------------------------RSGTAQ-V
>gi|46110274|ref|XP_382195.1|	   369 residues, 50 /line  hypothetical protein FG02019.1 [Gibberella zeae PH-1]
MPLLP----------RINPDA--A-----------------------------ATPQ--S
K------RATLK--------AFLRK-WLKVNYQDLLCMAFVGALAYGIYHS---PVIITR
TFPI-TFDATSG------DIVYPQWAYPDRG-----WIIPAWLSGLISIAIPIITYIVAQ
I-----------------------------------------------------------
---------QIKSVWDASNAIIGTVWSVTLASLFQVTLKQLVGGFRPYFLDVCMPDISLA
KTHNKTGLN-GVGFYQIM-Y-TTEICT-QP----DQSRIQNAITSFPSGHTTAAFAGFGF
LFLWLNAKLKVWA-----------------------DH-----KPAFWKLSL-TFVPVLA
AVLIAGSLTIDAAHNWYDILGGGFIGTIMAFASYRSTYASVWDW---RFNHLPLQETESF
RYGFD-------------GDLDYAAQTLSLAAGWG---GKKVRLPESSSGPAISTES---
-----------------TLRSGAEEIENLDANT---------------------------
----------------------------RRKRRGPVGEEA-V
>gi|46121977|ref|XP_385542.1|	   292 residues, 50 /line  hypothetical protein FG05366.1 [Gibberella zeae PH-1]
MRQM--------------------------------------------------------
---------------------ETHS-LQTTHAPDYVGFLFLLAG-WI---L---TVLFVD
PFHR-MFFINDL------QIS-----YPYAVHER----VPVFMNFVYALFIPLGVLIAFN
VAT---------------------------------------------------------
----------RAPAAKHEVTYLSFLISIVLTSFITDIIKNAVGRPRPDLLDRCQPAVG--
------------TKANTLV--TIDVCT-RE----DGHILQEGWRSFPSGHSSFSFAGLGF
LSLFLAGQLHVFR-----------------------YAA---GGRDLSRALV-CLLPLIG
AGMVAISRCEDYRHDVYDVCVGSALGMSIAYWSYRRHWPRLSSQ----KCDEPYPRPG--
------------------------------------------VDTQPGWQRFTDDEEA--
--------------------ARGTDVGF--------------------------------
-------------------------------EMDNLRGSR-R
>gi|50345080|ref|NP_001002211.1|	   266 residues, 50 /line  phosphatidic acid phosphatase type 2 domain containing 1B [Danio rerio]
------------------------------------------------------------
---------------------MRKT-IDNGFIAEVAVRLLLLGL-FL-------VTEELP
PFSR-EIQPEEL------WLYK---FHPVK-KDR----VPTRFMFAIALFTPLLVIFLFA
FLK---------------------------------------------------------
----------QGGKGDLKEASLAVTLTLVLNGVFTNAVKLAVGRPRPDFFYRCFPDGQMN
PE---------------------LHCS-G-----DPDVVMEGRKSFPSGHSSFAFAGLGF
TALYVAGKLHCFS-----------------------TA----GQGKAWRLCA-FLTPLLF
AILIALSRTCDYKHHWQDVLVGSLLGLVFSYLCYRQHYPALNEP----DCHRPLRMR---
---------------------ETA------------------------------------
-----------------------------LPAA---------------------------
----------------------------ERKQANPGYLLP-L
>gi|50424917|ref|XP_461050.1|	   309 residues, 50 /line  hypothetical protein DEHA0F17182g [Debaryomyces hansenii CBS767]
MDNVK----------KKVYSA--LNY-----FH----------------TDDDFNRV--T
F------GLKRN--------ALSAR-LVRWRFADLVLLGVLCVL-YI-------VTYKIE
PFQR-QFFINDL------TIS-----HPFAESER----VTNGALFFYSVWEPIMVIGVIG
LIM-------TKP-----------------------------------------------
----------ENKIYVTYVSILGLCISCFTTSVVTDVLKNLIGRHRPDFLARCVPRSD--
------------APLNVMVF-AKDVCT-TD----NLDLLKDGFRTTPSGHSSISFSGLVY
LSLWLSGQLVIMN-----------------------------ENLGYWRSIL-AWIPTLQ
CTYIALSRTEDYRHHFVDVIIGSLIGLGMACWAYRRLFPHITHP----KSYEPYIII---
------------------------------------------------------SEEEDN
------------DNPDTQYN----------------------------------------
-------------------------------RINQDESLS-V
>gi|50546837|ref|XP_500888.1|	   278 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
------------------------------------------------------------
------------------MLSSSST-LKQYHVIEWITAFTLIFL-WY-------VSESAA
PFTR-EFIISDP------TIN-----HSHVTVER----VSSEACILYTIIIPFFVLIGLS
AIM-------APRP----------------------------------------------
----------QDRLKFMSITLSTFLVAAFFNGFITNFLKIYMGRHRPDFIARCEPSKR--
------------APIDKYV--TIEVCT-GDM-----DTILEGMKSTPSGHSSTAFVGMTF
FCLWVYGQINAYK-----------------------TY-----GSKASKLLL-AFFPLLL
AIYIALSRTEDYRHHFVDIVLGSLLGMTIAYYFYRREFPRTTSK----TSHIPYCLG---
------------------------------------------------------SEGADD
------------DHHYDRVD----------------------------------------
--------------------------------DVQLENQ--V
>gi|54696046|gb|AAV38395.1|	   312 residues, 50 /line  phosphatidic acid phosphatase type 2B [synthetic construct]
MQN-----------------Y--KYD-----NAIVPE---------SKNGGSPALNN--N
P------RRSGSKRVL-------------LICLDLFCLFMAGLPFLI---I---ETSTIK
PYHR-GFYCNDE------SIK-----YPLKTGET----INDAVLCAVGIVIAILAIITGE
FYR-------IYYLKKSRS-----------------------------------------
-------TIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQI
NCSE------------GYI--QNYRCR-GD-----DSKVQEARKSFFSGHASFSMYTMLY
LVLYLQARFTW-------------------------------RGARLLRPLL-QFTLIMM
AFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVF-FVSDLFKT----KTTLSLPAP---
---------------------------------------------------AIRKEILSP
------------V-----------------------------------------------
----------------------------DIIDRNNHHNMM-L
>gi|56758956|gb|AAW27618.1|	   281 residues, 50 /line  SJCHGC05833 protein [Schistosoma japonicum]
MKP---------------------------------------------------------
----------------------FVY-GIIRVISDLAFIAALIIT-NT-------ILQNIE
PYKR-GYFPQDE------SIK-----KPYKS-----NTISSTILYIVSSLLILFTIVLGE
VIV-------GSKSLRRTH-----------------------------------------
-------HRIPVILYPIYDSLIVAFFGYFATIGLTDVGKVAFGRLRPNFIDACKPSGYTT
TNL-------------GFI--SNITCS-ADK-------STGLRKSFPSGHTSIAIYSATF
LCLYIQLRFSRYR-----------------------IY-------PSIRTCF-QMTYIAL
GLVVGYSRILDNKHHWSDVLGGGLLGFLLALSTLY-YLPYCGDT----TDSLPTCK----
-------------------------------------------------------DDQII
------------VEFDRP------------------------------------------
----------------------------ESSAFSPADKSS-Q
>gi|58259405|ref|XP_567115.1|	   354 residues, 50 /line  phospholipid metabolism-related protein [Cryptococcus neoformans var. neoformans JEC21]
MSSVA----------DAVRFC--FPT-----APIGPEAAID--FPLYARNESQLAQG--K
V------RHEEEERVVSPVQATFKT-ICASYAPDWIIVFVLWAV-LV-------ILDRSG
GHKR-EFSLNDV------SIQ-----HSFAEHER----VPPVLLVLFSIVVPLLVLVPLS
SL----------------------------------------------------------
---------IARNAWDTHNSVLGLLMSYTMTGVVTQIIKMSVGRPRPDLIARCMPIEGAM
DH-----------PVFGLT--NVSICT-NT----DAFILDDGFKSFPSGHSSMSFAGLGF
LSLYLAGKMHLWD-----------------------------NGGHRTRAWA-ALSPLLG
ATMVAISRTEDNRHHWQDVLIGSILGLFIAWVAYRTYYPPLSHN----QCHLPLAPRT--
-------------------------------------------DPDNYQDFPLDDEEQGR
------------GGPRDRVRLLSEETDGRAGEE---------------------------
--------------------------------QVAWQATG-R
>gi|66542055|ref|XP_623887.1|	   268 residues, 50 /line  PREDICTED: similar to phosphatidic acid phosphatase type 2 domain containing 1B [Apis mellifera]
------------------------------------------------------------
-----------------MSIIYGKD-FLVGYLFDILLRIVLVGL-FI-------ELEKAE
PFTR-IIHEDEL------WLYK----KPRTE-----SYVPTTILWPLVFTMPVIVIFCVF
L-----------------------------------------------------------
---------VYKDKTDIYQAILAVTLALGFNGVITDIIKLIVGRPRPDFFWRCFPDGQTN
PD---------------------FKCN-G-----NPVVIKDGKKSFPSGHSSFAFTSFGF
IALYIAGKLHTFS-----------------------L-----GKGQLWKLFA-FVLPICI
ALLIALSRTFDYHHHWQDVVVGSIIGYFLAYMCYRYYYPPLDSQ----VCHKPYAA----
-------------------LNQIH------------------------------------
-----------------------------CCVG---------------------------
----------------------------EMLSQLPVHGED-S
>gi|71749074|ref|XP_827876.1|	   332 residues, 50 /line  phosphatidic acid phosphatase [Trypanosoma brucei TREU927]
MATGG-------------------------------------------------------
-------RSSFA----VYLYY-----AKVLRLLDYLVAFCFGAT-GF---L---LGRLIR
PYCR-TFSWDDL------SIN-----NSFAEKET----FPDWSLVVMALVSCLFIFIIEK
MRERYSPVGEWYMDEQLPEPSSNSITSSTNVLSEERAANR--GGASVRERNGLENLPPAP
SFERK-VQRKFIVDQVINLWILSVVFAFFFSLGIVDVLKIYAGRLRPDFLDRLRREGFNA
TS----------------P--PSNAC----------SLAREGRLSFPSGHSSCAFAAFTP
LTMYFLGLSRAFN------------------------------SGPVWRIIL-SMFPIYL
AICVAASRTRDNRHHFSDILGGSVIGLVIGAFSVNIFFRVRSGE----GYLVPRRLEPPR
R-----------------------------------------------------------
------------------------------------------------------------
------------------------------RSGSPNDNDT-V
>gi|71660303|ref|XP_821869.1|	   315 residues, 50 /line  phosphatidic acid phosphatase [Trypanosoma cruzi strain CL Brener]
------------------------------------------------------------
-------MLPYQ----K----VLKV-LQKLRIVDYLLCVFLCTA-AL---T---IGKKVR
PHCR-QFSWQDA------TIG-----HTYAGAGL----FPSWSLAPIAIL-PALIYFVVE
LIR-AL---LWRPDTRPSHGPSTSLDLVTNALETRNSERMNMRRCHTEEADGGTVINTSD
GEEAGGNARWWLFLEKLNHWLLAQAFSVTLSMFIVDITKLYAGRLRPDFLARLENEGYSE
KS----------------T--GVDWC----------KVAREGRLSFPSGHAAISFSSIVT
LVLFFVGHLQVFY------------------------------FASPLRLFL-SMLPLIL
PIVVAVSRTRDNRHHFSDVLAGGIIGTGCALLSVTVLFRVVKRN----GMFLPRRQ----
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------DYASK-R
>gi|6320711|ref|NP_010791.1|	   274 residues, 50 /line  Lipid phosphate phosphatase, catalyzes Mg(2+)-independent dephosphorylation of phosphatidic acid (PA), lysophosphatidic acid, and diacylglycerol pyrophosphate; involved in control of the cellular levels of phosphatidylinositol and PA [Saccharomyces cerevisiae]
----------------------------------MISV-MA--DEKHKEYFKLYYFQ---
------------------------------YMIIGLCTIL--FL-YS---E---ISLVPR
GQNI-EFSLDDP------SIS-----KRYVPNEL----VGPLECLILSVGLSNMVVFWTC
MFDKDL---LKKNRV-KRLRERPDG-----------------------------------
---------ISNDFHFMHTSILCLMLIISINAALTGALKLIIGNLRPDFVDRCIPDLQKM
SDSD-----------SLVF--GLDICK-QT----NKWILYEGLKSTPSGHSSFIVSTMGF
TYLW----QRVFT-----------------------TR------NTRSCI-----WCPLL
ALVVMVSRVIDHRHHWYDVVSGAVLAFLVIYCCWKWTFTNLAKR----DI----------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------LPSPVS-V
>gi|66824401|ref|XP_645555.1|	   366 residues, 50 /line  phosphoesterase, PA-phosphatase related-family protein [Dictyostelium discoideum AX4]
MENSG-------------LLF--NND-----ETIINKKIKK--IIYENQYDKPLFYD---
------------------IDLRKNN-KKLIYLLDWFCVVVLLVI-GS---I---LLLKVP
VRGR-LFRLNDE------SIS-----YPKLE-EI----IPLGLLIPLVTAVPFAMILLIS
IIF---------------------------------------------------------
----------KRDINDFHHSLLGFLQSISVTILLTGSFKVFIGGLRPSFLEFCKPTKESI
VAGN-----PPVGYGAIYY--DRSICT-ES-----EFIVNDGLSAYPSGHSSIAASCFGF
LALYLLARLKCFD-----------------------NR------GHIIIYLL-IIGCLIT
AGLIGISRVADYRHTFLNVLAGWSIGLLISLSCYRLNFSSLFGR----DNHISIHSHWLT
YWDYH-------------NNNNNSNSNN-------------NNNNNNNNNNNNNNNNNNN
------------NNKKDNINNNSTKTQNNFESY---------------------------
----------------------------QSPNGIPLNELQ-N
>gi|66809727|ref|XP_638587.1|	   271 residues, 50 /line  phosphoesterase, PA-phosphatase related-family protein [Dictyostelium discoideum AX4]
MIH---------------------------------------------------------
-------RVSFY----G----KTTW-FTKQHLIDWFLCLGIFVIESV---L---FNFVIP
PFKR-YEPESNISTNTFQLVQ-----YPLLP-----DIVPVWLLMLIALGLPMVVFIGYY
I-----------------------------------------------------------
---------KNRNSHDFHHAALGLFQAFTITMLFTDILKVSAGRYRPDYGARVAT-----
----------------------------GI-----EAVIREGRVSFPSGHSSVSFCGMTF
LSFYLCGKTKVFL-----------------------KD-----GGNILKALV-CLCPFMI
SALVAVSRTVDYHHDFSDILAGSVIGLSIGVFVYFMNFNSLFSK----ECS---------
--------------------------------------------------LPKN-RINPH
------------Y-------AR------DGLLS---------------------------
----------------------------AEYQSLSISSS--L
>gi|67467281|ref|XP_649759.1|	   255 residues, 50 /line  lipid phosphatase [Entamoeba histolytica HM-1:IMSS]
------------------------------------------------------------
-------MSIWT----KIKHSFSLL-DISEIFSDVIVFGISLLT-I----V---ITLFCS
PNQM-VIPNEKNNV----NVD-----YLYVEKE----TIPFWLCALISYVPPLLLILLFS
L-----------------------------------------------------------
---------FKKSSKFLFYSLFCLILCISSNIAITNCAKLFAGRPRPHFYARLSEH----
-----------------------------------PEQVKSVYQSFPSGHSSSISNGMTF
CTLFLAGQMKIFA-----------------------------SSQESWKLLV-VSLPSIV
AIFIMITRTRDYYHNFSDIIGGGIIGLFTAFIFYCNKFNSLSSD----HSD---------
---------------------------------------------------DLKITSISQ
------------L-------EDQTD-----------------------------------
-------------------------------------IFD-V
>gi|67467677|ref|XP_649928.1|	   250 residues, 50 /line  hypothetical protein 259.t00003 [Entamoeba histolytica HM-1:IMSS]
MNK---------------------------------------------------------
----------------------VLN-ILFQIGGDIIYIIVTGAV-AA---V----LTFID
GFHM-EVPGGENNV----NVL-----YPYRD-----STFSEAVAGIVIYASTILIIIAFQ
I-----------------------------------------------------------
---------KRLSFKHTIFTFIGLGASVTTWLMFVQGGKIYAGRPRPNMYALVA------
-----------------------------------QGKEKDAWKSFPSGHSAASFCGYTY
LSLYIAGELRIFS-----------------------------DRPELWRMIP-VIIPMFL
AGIIVLTRTRDYYHNFSDVLAGSIIGILSACIGYFSKFESLFSP----KAG---------
---------------------------------------------------EIRLTCRNH
------------K-------KNNEDIPDE-------------------------------
-----------------------------------EMAEM-S
>gi|67469998|ref|XP_650970.1|	   245 residues, 50 /line  phosphatidic acid phosphatase [Entamoeba histolytica HM-1:IMSS]
------------------------------------------------------------
-------MLNFR----S----IKQQ-CTKTLVIEFSIGVILFVG-GI-------LLKYLP
SYQM-DIPLERKNF----NVT-----YPLVS-----ETFPFLFCCIFSWCIPVIVIFYFA
Q-----------------------------------------------------------
---------KRNSSKYFITSITSFFFAVSLCLFLTNAFKLFAGKPRPNYYSLIDN-----
------------------------------------KKASKVYQSFPSGHSSTTFNGMMF
LTLLLCGEYKIFN-----------------------------GEGSILKLVG-CCLPLLF
GCIVAISRVRDYFHGYDDIIAGSLLGCLTAVLCYVLKFKVLWST----NSG---------
---------------------------------------------------EIETEEYKE
--------------------FDDNYI----------------------------------
-----------------------------------------V
>gi|67473662|ref|XP_652582.1|	   259 residues, 50 /line  lipid phosphatase [Entamoeba histolytica HM-1:IMSS]
------------------------------------------------------------
M------DILQQ----LYLPLLHKS-VLLNVIYDIVVIVIFVII-SI-------VCVFVT
PHHM-DIPKDRENV----NVL-----YPLYS-----SSVPTWACIIIGYIPPVLTILLIT
I-----------------------------------------------------------
---------KKKSSLFLLFSLLSLGLSASMCLGVTNMGKIFAGRPRPHFYARIDAK----
-----------------------------------PNEINDAYMSFPSGHSSAIFNGMTF
LALLIAGQIHAFS-----------------------IA-----SHESWRMLI-VLLPFII
AGTVAISRTRDYHHNFSDIIAGSLIGIFFALLSYCSKFKRLSDE----HSD---------
---------------------------------------------------DLKIEDVVK
---------------------SQEPFPLE-------------------------------
------------------------------------DEEK-Q
>gi|67478931|ref|XP_654847.1|	   243 residues, 50 /line  lipid phosphatase [Entamoeba histolytica HM-1:IMSS]
MWKE--------------------------------------------------------
---------------------QWIT-FLKKRKIDIIITFIVFVL-SK---L----FGLLP
PFKM-ETPHNHP------SYH-----YSKHE-----NTFTRNMTITIDFFIPLICIILLC
L-----------------------------------------------------------
---------KNHYISGLFNSILSFIFNDSLNGTITQLYKIFAGRPRPFYFNGCNPSL---
-----------------------YTCT----------------KSFPSGHSSFSMAGLLF
LSLFLYFYFKKSN-----------------------IH-----LNSLSSVFF-CGLPSFL
AIIIAVTRTRDHYHHFSDILGGSILGGFVAIISFFSTFQRFYTE----EED---------
--------------------------------------------------ETVDYE---I
--------------------INNKTVLL--------------------------------
--------------------------------------EE-E
>gi|68484435|ref|XP_713828.1|	   261 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Candida albicans SC5314]
------------------------------------------------------------
----------------MLQIYFTSS-KFRKFIPDWIVVILLVII-FF---Q---VTEVAQ
PFAR-QFYINDP------TIS-----HPFATQEQ----VTDNQLYLYSVLIPSLIISLIS
LYL-------GESN----------------------------------------------
----------FEKLHNLQVSCLGLWLSVCVTSVLTDVLKCWISNPRPDFLERCGPQKG--
------------TPENKLV--GIEVCT-SPL---GPMYLSDGLKSTPSGHSSMAFSGLLY
LSLWLVGQFKLIQ-----------------------KR------KSIGYVLI-AGLPILV
AAYIALSRTQDYRHHFFDIGFGSAIGIVFAVIFYYKYFNSLSDE----SCN---------
--------------------------------------------------VPIDYK----
------------------------------------------------------------
-----------------------------------------D
>gi|68486075|ref|XP_713054.1|	   284 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Candida albicans SC5314]
-----------------------------------------------------------M
T------FLNPS----SIVKYTQSN-QFHDFIPDWIVATVTVLF-FF---S---VAETAL
PFQR-QFSLDDL------TIS-----HPFAIKER----VSGILCIEIAAFVPLFVILTSL
LVK-------YQQGA-FSS-----------------------------------------
---------HQQALHCLQISVLGLIISLSLNGVITDILKIWIARPRPDFLERCGPAPG--
------------TPLHELV--DVNVCT-APL---GKALLIDGMKSTPSGHSSISFGGLFY
LTLWLLGQFKLFQ-----------------------NRE---SPQYVYKYFL-AFSPLSL
ATYIALSRTQDYRHHFTDIVLGGAIGISFAWWSYHHYFNKLVSE----ESH---------
--------------------------------------------------KPIDSETLTE
------------------------------------------------------------
------------------------------------SLLP-H
>gi|68487344|ref|XP_712443.1|	   362 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Candida albicans SC5314]
MKREI-------------FFS--FKW-----PFFLGLCSLS--CLCRCKKNTQIMVT--D
W------VFTIN----RLQFS--GL-TTISYIFDFLFYLTILIL-SA---T---LGRTLP
PRYH-EFSLYDI------TLR-----YTHFPEAT--ILVRVWLLVLISAGIPLTQFLLFS
IFV-------VLPI----------------------------------------------
----------RRRIWDFLAGCLCLLGAMATQLLVTVLLKNIIGLPRPDFIDRCEPMIQNI
PLTS-------------LS--TVAICT-QP----DWNLVQEGFRTFPSGHSATVFTGMTI
AALNFAARLQTFD-----------------------------NRNNSFKVFI-TISPWLI
AACVASTRVSDNRHFLKDIIAGAFIGTCIGSVFYLQYHPSIFNL----ANAGRS--FPPR
RFGIQ-------------RFFQNIGGFW-------------KLDGESSD-RALGAEDLEK
--------------------LSNEQLGQPARIT---------------------------
----------------------------SMADNIEVVNKL-L
>gi|70995150|ref|XP_752340.1|	   353 residues, 50 /line  PAP2 domain protein [Aspergillus fumigatus Af293]
------------------------------------------------------------
M------RPALS----RIPLR-----LVFSYILDWIFIVIVAVI-GF---G----FHKVQ
PNHR-PFSLTDP------SIS-----FPYTEHET----VSTAVLMVVALIAPAVIIVITA
LLI-------PMSTK-DQNVPRSSL-----------------------------------
---------WRYKLWEWNAGWMGLAVACAWAWMATEGLKDLYGRPRPDMLARCNPDLSNI
ATYAVGGLGENLAGAPTMV--TWKICQ-NK----SKVLANDGFASFPSGHSSFSFAGLTY
LTLWLCSKLSIAFPYLGHS--LLNQNPIGPINGSIRKRG---AAPPVYMLVV-AFVPIAV
ASFIGASRWFDYRHHAFDILFGSIMGAIFAWIGFRMYHLPITRG----EGWSWA--ARSR
R---H-------------AFFKSP-----------------RFPSEADERRPIDTHDTQK
--------------------TTRQDIDV--------------------------------
---------------------------------ERAAENL-V
>gi|71411248|ref|XP_807881.1|	   317 residues, 50 /line  phosphatidic acid phosphatase protein [Trypanosoma cruzi strain CL Brener]
--MSA-------------CVR--VVV-----VFFFLCVCVS--FSLFFVPFSPLWGV--S
V------GMDIN----RLVLY-----WKNYQLLDFVLGLFLLIF-SS---I---LVFVVP
PYCR-PFSWNDP------TIN-----YPYVTNVA----FPAWSLLLMFVLALIFYVAVLT
SL----------------------------------------------------------
----------GGPIW---VWLKAQTLAVISQLVVVNLLKIYAGRIRPDYLERLRSLGIDE
NTYAKIDV------KYMSS--TEFYCKLGV----EHRVLREGRLSFPSGHSSTSFSVLAF
MSLFLFAHTQPSS-----------------------------RGGSFLRLIL-SLSPLAI
AFLCAVSRTRDYWHHFDDIVAGALIGTVSALMCFYNAFYITEDG----RCVARV------
----I-------------ELAQQE-----------------ERAGEISNG----------
------------------------------------------------------------
---------------------------------RPLSVVV-A
>gi|49256534|gb|AAH71101.1|	   257 residues, 50 /line  MGC81169 protein [Xenopus laevis]
------------------------------------------------------------
------------------------------------------------------MSLVNS
PYKR-GFYCNDE------SIR-----YPYRE-----DTITNGLMATVTISCTVIIISSGE
MYM-------VFSKRLYSR-----------------------------------------
-------SECNNYIAALYKVVGTYLFGAAVSQSLTDLAKYMIGRPRPNFLAVCDPDWSTV
NC-------------SR--YVTDFTCR-GN-----YANVTDSRLSFYSGHSSFGMYCMLF
LSLYVQARLCG-------------------------------KWARLLRPTI-QFFLLSF
ALYVGYTRVSDYKHHWSDVLVGLLQGALVAAFTVRY-VSDFFKIRPPLQCTKDPLESKP-
------------------------------------------------------------
------------------------------------------------------------
------------------------SLQLSESDQNHFGYLGGS


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.