Fandom

Proteins Wiki

At2g01180.1/MSA

< At2g01180.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|56758956|gb|AAW27618.1|	   281 residues, 50 /line  SJCHGC05833 protein [Schistosoma japonicum]
------------------------------------------------------------
------------------------MKPFVYGIIR-VISDLAFIAA-LIIT-----NT---
ILQNIEPYKRGYF--PQDES------IK--KPYKS-----NTISSTILYIVSSLLILFTI
VLGEVIVGSK-----------------------------------SLRRTH---------
------------HRIPVILYPIYDSLIVAFFGYFATIGLTDVGKVAFGRLRPNFIDACKP
SGYTTTNLG---------------FISNITCS-ADK-------STGLRKSFPSGHTSIAI
YSATFLCLYIQLRFSRYR------------------------------IYPSIRTCF-QM
TYIALGLVVGYSRILDNKHHWSDVLGGGLLGFLLALSTLY-YLPYCGDT----TDSLPTC
K-----------------------------------------------------------
--DDQII--VEFDRPES-------------------------------------------
-----------------------------------SAFSPADKSS-Q>gi|108881118|gb|EAT45343.1|	   306 residues, 50 /line  phosphatidic acid phosphatase [Aedes aegypti]
-------MNKNGSVT-----------TPATPVSKST------------------------
---------------------SINGNGVASANIN-LFQEIVIRLM-LFGLY----FY---
-FELKEAFVRVIH--PEEMW------LYK-NPIS-----PSYVPLALLYPAVFGLVGLVI
IGYFIR------------------------------------------------------
---------------SRDFQDFKCAWLGFSLACTLNGAITDVIKVSVGRPRPDFFYRCFP
DGQMNED---------------------MACT-G-----DAWTVKDGRKSFPSGHSSFAF
AALGYLAWYLFAKLHVFT-----------------------ERG----RGQTWRLLA-SG
GPLFAALMVAISRTCDYHHHWQDVTVGSLIGLTVGYLSYRQYYPPLDSR----HCYLPYS
SEVISP------------------------------------------------------
----NSNRKSVSKRDQVPD-----------------------------------------
---------------------------ESESDTKMLLGGEEKESKWT
>gi|111069427|gb|EAT90547.1|	   370 residues, 50 /line  hypothetical protein SNOG_02335 [Phaeosphaeria nodorum SN15]
MPST------------------SDAAKPAASSAELAHVTSRQPQSTSNRSTSPSSL----
KHDLESANPNPSH-YNHWLPGFHNPPLFLTFLR-HNWYDIGTQLL-CLLTSLLLYAFCQP
ILPRYFPLFRGVE--RTSWGM----KHS--QPYLS-----EYVSTITSAIISFAVPAAIM
GAIALWG-----------------------------------------------------
---------------TRGFGDGNAALIGLGYALSTATLFQSFIKIFIGGLRPHFLTICNP
RIPPSLPGL---STLRDGDLHF--YTASQVCR-G-----DANKVREAQMSFPSGHSCAAF
AGFGFLALYLNAKFKVLS-RGGHFRDYYGDKAWERSERSE--RGDGMERVHHWKLVL-FV
APWCIAILFALSKIRDAWHHPVDVVFGALVGTLFAHMAYKMAYRSVYDS---RTNHIPLE
GD----------------------------------------------------------
------------------------------------------------------------
----------------------------------GGDFNKEEVK-DK
>gi|115629247|ref|XP_787511.2|	   258 residues, 50 /line  PREDICTED: similar to Phosphatidic acid phosphatase type 2 domain containing 1A [Strongylocentrotus purpuratus]
------------------------------------------------------------
-----------------------------------MILELLVRIF-LLIAF----LI---
-TEELDPFQRVIQ--PEEMW------LYK-NPHSVH----STVTTRMLFSSAILVPLCVI
TIFSLM------------------------------------------------------
---------------RKDRLDFLHAVLDLDLSL---------YHCIVKKPRPDFFYRCFP
NGVMTT---------------------DLKCT-G-----DLDTINEGRKSFPSGHSSFSF
CAFGFTAFYLAGKLHTFE-----------------------SRG----RGVGWRILV-TL
APLYVALMVALSRTADYRHHYEDVIAGSLLGLAVAYAIYRQYFPALTHA----TCDKSYA
RLYALR------------------------------------------------------
-------------------------------------DAMSLQEYNT-------------
-------------------------------NNAISTRIPLDSVKTV
>gi|116056575|emb|CAL52864.1|	   291 residues, 50 /line  putative phosphatidic acid phosphatase (ISS) [Ostreococcus tauri]
MASSSGE----------------------------------------------------R
GETAREAREEREE--------TSNLMTRRARART-LAVDAVAFGL-MFSLG----TW---
-LEVAEPNQKYIQ--QEML-----WRYS--YPHKE-----NTVPTVVVPIISFLIPLACM
LAVPRS------------------------------------------------------
---------------WNPHVRKERAIGGLTVSVGLTWVVTCAMKNIIGNIRPDFVARCWP
DGNIVWAS-----------------AGVPKCS-GAN-----DDVQQGRRSFPSGHTSMSF
SGLFYCSLYLAAWFRVGR-----------------------EERKFRRWEAVWKLIV-VL
GPTLLAMFVGLTRIRDYWHHWEDVLVGATLGTTFAYVSWVYKKPYVRPSGFGFNE-----
------------------------------------------------------------
------------------------------------------------------------
---------NYTPLGRSAEDFS----------------------LVD
>gi|116505206|gb|EAU88101.1|	   260 residues, 50 /line  hypothetical protein CC1G_11524 [Coprinopsis cinerea okayama7#130]
-MEK------------------GPAEMPSRDHEPA-----------ASVSSQQPLAQQPR
--------AQQTQA-----------FNLVVWLK-LHGVDIITMAC-MGAVALGVH-----
---LAPAPSNDFPIYNVDGS------IM--YPEYSFPRKTQIVPIWASALMAIFIPLVFF
VLAQA-------------------------------------------------------
--------------RRQSVDDLLTTFLGLIKSVVSSSVFQVIIKATIGGLRPHFYDVCKP
LVSPGD------APSGIGFNDI--IYDPSICT-G-----DSEHIKDALRTMPSGHSAAAW
SGLMFLAFYLNAQLKVIS-----------------------GN-----NPAYWKSVL-FL
APILGAFLLSAYL----------ITIGQ--------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------T
>gi|118793866|ref|XP_321121.3|	   249 residues, 50 /line  ENSANGP00000019070 [Anopheles gambiae str. PEST]
MSGVAYA-----------------------------------------------------
-----------------CGGTTGQKKLPRAPEYN-LPLETVVRIA-LTCIY----IA---
-LEFKAPFVRKIQ--PEELW------LYR-NPRTD-----SYVPLTMLWPIVLGVPGLAF
TLHYLR------------------------------------------------------
---------------TRDRQELRCTVLAFTLGLGLNGVITNTVKIAVGRPRPDFFWRCFP
DGVL---------------------NDELHCT-GK----DMRALIDGRKSFPSGHSSFAF
VGLGFLTWYLIGKLHLMN-----------------------ERG----RGRSVRVIA-AG
LPLFAATMIAISRTCDYHHHWQDVTVGSLIGIVLSYLCYRQYFPAF--------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|119194029|ref|XP_001247618.1|	   265 residues, 50 /line  hypothetical protein CIMG_01389 [Coccidioides immitis RS]
-------MAQNDLP------------------------------LHGNRKPSGISARP--
---------------------GCLGAVARF-WYRSYAADYISLAI-ITAGW----FI---
IQIFVEPFHRMFS--LENGS------IQ--FPFAVVER----V-----------------
------------------------------------------------------------
--------------------------------------PVDVVKNAVGRPRPDLISRCKP
EKG--------------TPAHT-L-VSFNVCL-ET----DHHILHEGWRSFPSGHSSFAF
GGLGYLSLFFAGQLHVFR-----------------------------PRSGLARFLF-SG
APLLGALMIAMSRLADYRHDVYDVTVGSLLGLFTAYFTYRRYYPSLKSI----DCDTPYS
RPSGGY-----------------------------------------------------V
AVSGVNR--GLGDEEQPCN--------------------------------SPRPEYSGA
------------------------------------EYQM------Q
>gi|121699191|ref|XP_001267939.1|	   309 residues, 50 /line  PAP2 domain protein [Aspergillus clavatus NRRL 1]
-------MPRNGSA---------------------------------------TGPKPT-
---------------------GVPGILARFYQRSYPAVDYVALAC-LAGIW----VM---
IQLFVDPFHRMFS--LDNRS------IQ--YPFAVVER----VPVLWSIIYAGLIPLLVI
ICWAAVF-----------------------------------------------------
---------------RPKPYQVQLTVLGLLVALMLTSLITDIIKNAVGRPRPDLVSRCVP
KKG--------------TPGNA-L-VAWTVCT-QT----NNHILQEGWRSFPSGHSSFSF
AGLGYLSMFFSGQMHVFR-----------------------------PRADLWRCIL-AL
IPMLGALMIAISRLEDYRHDVYDVTCGSLLGLVVAHFSYRRYYPALRSA----ACDTPHD
FTDS-------------------------------------------------------P
GPNGFSK--LPADEEQQIH--------------------------------GRSWEAETY
------------------------------------PLEELPPHNGR
>gi|123471801|ref|XP_001319098.1|	   253 residues, 50 /line  PAP2 superfamily protein [Trichomonas vaginalis G3]
-------MIEIDERDP--------------------------------------------
--------------------------LWKRILYFIDYQDMIISIL-ALAV-W---LG---
-LSTIEPNYLYIP--ENDGD------SN--YPMKK-----SQIPFLLLSFIVFGGFNLIF
IGLYFLARR---------------------------------------------------
------------YPKYFCRFDLFPVAWGLVFAISMSNIFVNVPKSYVGRARPDIYARCGV
K-------------------------NLTECP--------QKILKEEHKSWPSGHSSTAM
SATIYMAAFFIKFLYA----------------------------------KPYAIIF-SA
LFALFGIYVGATRIVDFRHHPDDVLAGLFIGFIAAYIVWENLSTKIFIESNQK-------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------DETLPLPQTITQ
>gi|123503270|ref|XP_001328470.1|	   250 residues, 50 /line  PAP2 superfamily protein [Trichomonas vaginalis G3]
-------MKLFKTLGS--------------------------------------------
-----------------------EFTYFWKSFLE-NLPEWFATIC-LGLVS----VV---
IALMIEPKERIAF--FENFN------ER--YPYSG-----ETLGIPIVALLIIILPCAVL
GILTLAY-----------------------------------------------------
----------------PRRMELNLAGMSLAQSLCLTLLITEALKVTVARPRPNFFSYCQY
DQNA------------------------KKCT-GPS-----SHKRDARLSFPSGHASNAF
ATGTWMCLFLGEFFH--------------------------------NSEEIWWIIL-RF
IPIMIATFIAATRITDYMHHVSDVISGVVIGIGCSTIIFRAQSNRIFMTNHRR-------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------EEPVSLL
>gi|125828555|ref|XP_697507.2|	   303 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
-------MEVGASS------------------KWVGHELQKVMQ----------------
-----------------------LYWGKYSTLLT-FVLFLSLLFLLVGLPF----AI---
LTIQHKSFKRGFF--CNDDS------IK--YPYKE-----DTISYQLLGGVMIPVTLLTM
IIGECLSVYLNRIK----------------------------------------------
----------SNSFCNGYVACVYKAIGTFVFGAAISQSLTDIAKYSIGRLRPHFLDVCKP
DWSKINC-----------TAGA--YIEDFVCT-GK-----ESVVNEGRLSFYSGHSSFSM
YCMLFLALYLQARMQAE-------------------------------WARLLRPTL-QF
FLIAASVYTGLSRVSDYKHHWSDVLTGLIQGAIVALLVVFF-VSDFFKKKVEPQKETEIP
H-----------------------------------------------------------
------------------------------------------------------------
-----------------------------TTLQETPTNGNHYDNP-N
>gi|126137015|ref|XP_001385031.1|	   361 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Pichia stipitis CBS 6054]
------------------------------------------------------------
-MDIHDWS-----------FSYMKHDISGLSFLS-YVVDWIVYVA-ILTVA----IL---
FGSVIPPWYHEFL--TNDIS------LM--YSHVSEED--TVIPINILLVITVVLPLLQF
VLCALYSPSS--------------------------------------------------
--------------GTRRAWDIFAGLTCLCGSMATQLMITCVLKNICGLPRPDLLSRCQA
DIDLV-------------PDEG-L-LTVAVCT-ND----NIFLLQEGFRSFPSGHLSTVF
CGMVVTSLNIAGKFQVFD-----------------------------KRAMSTKIFL-TI
VPIIVACFVACTRISDNRHFLRDVVGGAIIGSSAAVWFYSQCFPSVFHL----ENAGRA-
-YPPRRFG--------VAAFFNNVGGFWAL------------REKIPGSFMDRI------
---------LNTRSTLELLKNSDPIVNGEIDNPD---------------ELVNIQSNIRF
LNRIAPIFK-----------------------NRTLNLNTKQEETSV
>gi|145231560|ref|XP_001399257.1|	   348 residues, 50 /line  hypothetical protein An02g01180 [Aspergillus niger]
------------------------------------------------------------
------------------MLSTQPRRTSKRVIAS-YLLDWAFIII-LVVT-G---GI---
-LYKITGSEHVFS--LDDAN------IS--YPLKS-----DTVSITTVGIVCCVVPALLI
AAICLLTPLP--------------------------------------------------
--------------WHRRLWEWHAGWLGLALSLAGAFFLTSGLKDVVGKPRPDLLARCQP
DLTNLTTYAVGGLGLQRAESPV-M-VTSAICQ-NP----DATVIKAGFAAFPSGHSSFSW
AGLLYLSLWMGAKFAVSVPVRSTA--LSAAGRDKKTDSSFSRASAI-AAPPLYLLVL-IA
IPVGGALYICASRYMDYMHAGWDILGGSLIGIVFAILGFMWYHAPAGLA----YGGWAWG
S-----------------------------------------RQSDGAFGAGFGDGLCAG
SGSRNKEGS-----------------------------------------RDGYQDLELG
----------------------------------AMHASQGVIR-DA
>gi|145257482|ref|XP_001401753.1|	   298 residues, 50 /line  hypothetical protein An04g03870 [Aspergillus niger]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------MLVESPGLTSLIGVSLAQEVRTRY--------P
DCR--------------TPLSV-L-ANMHLSK-TA----SDHGLQVGQR------FKTSF
AGLFYLTLWLSGKLHIMD-----------------------------NRGEAWKTLL-VM
IPSLAATLVAVSRIMDARHHPFDVITGSLLGIICACISYRQYFPSLNEP---WKKGRA--
-YPIRTWGRDPVGPVETVRLVGTDGSTAALRNPEEERLNEAPQSKTTGSDAGRPLYLPES
NPYTTNMYGYSR--RDEDD-----NWSSSSEDVAGGYEMQPGYARTQNPALNGPTARLDV
DTA-YHSQTPQVVLGAATTHETPGAIPTHADRGRDLTDMPYRE---V
>gi|146415899|ref|XP_001483919.1|	   243 residues, 50 /line  hypothetical protein PGUG_03300 [Pichia guilliermondii ATCC 6260]
------------------------------------------------------------
-------------------------------MSK-FNAEWLVVVG-LLLYF----YL---
VAEPSKPFVRPFR--LSDPS------IQ--FPFATHER----VTDNQLYVISCILPSLAI
TAWCTALLKRK-------------------------------------------------
-----------KLTKFQFQQLVNTSLQNLWLSISITGVITDVLKAWIARHRPDFLERCGP
IVG--------------TPIDK-L-VGIEVCS-APL---GQIYLVDGMKSTPSGHSLIAF
AGLFYFSLWIYSRIGHLS---------------------------------IGYQLS-SC
LPSLLATYIALSRTQDYRHHYSDIIIGSAMGIAIATITFFRKEK--------DKTELP--
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------L
>gi|146420035|ref|XP_001485976.1|	   348 residues, 50 /line  hypothetical protein PGUG_01647 [Pichia guilliermondii ATCC 6260]
-------MISLQGLYADR------------------------------------------
--------------------PLGKLPISLYTATS-CGLDWFLYLF-FATIS----IT---
LGVLTLP-SHEYA--VQDLR------LQ--YSYTPNET----FPIWQLVFITIVCPPILF
FAISCLDFRR--------------------------------------------------
------------VTIFRILWDTFAGLTALCGSMATQILIVCVLKNTLGLPRPDFLDRCQP
SIEF--------------GM-----GTIADCT-ST----DDGILREGFRTFPSGHSSTAF
TAMTMVSLFSAGKLQVFD-----------------------------NRGVSIKIAL-VV
APMILASTIASSRIADNRHFLSDTLAGAAIGIFCAYWFYRQYFPSVLLL----TNKGRA-
-YPPRRNG--------VSHLFGNVGGFWFI------------EESDNGQYCKRC------
---------LNRPSTCKKL-----VQLGIV---------------DHDTHAVSVGSSLEA
ASK-AKAQL------------------------GHTVNLDT----PL
>gi|146453151|gb|EDK47407.1|	   304 residues, 50 /line  hypothetical protein LELG_05588 [Lodderomyces elongisporus NRRL YB-4239]
-------MSMEGLLNNL-------------------------------------------
----PSPQ------FNRANLGF----IPRRIVKW-RVTDLALLAV-LVIS-Y----F---
FIYRIKPFHRQFY--INDIT------LQ--HPFAERET----VNNLELFIYSTWVPLVIA
LITSLILTK---------------------------------------------------
--------------PKYKVYNTYVACLGLLLAVLVTSNVTDILKNLIGRHRPDFLSRCKP
DPS--------------TPKDV-L-VSIEVCT-SK----DTGLLEDGYRTTPSGHSSIGF
AGLVYLALFLMGQFQANS-----------------------TR------VGSWRTLLCGF
TPLLVASFIALSRTEDYRHHFVDVFIGSMLGLVIGSWSYLRLFPWISNP----QSYSNLI
MI----------------------------------------------------------
--------------------------AEEEEDAE-----------NRHKVGDVVIDGEA-
----------------------------------------DTMLEDV
>gi|18379166|ref|NP_565255.1|	   327 residues, 50 /line  ATPAP1 (PHOSPHATIDIC ACID PHOSPHATASE 1); phosphatidate phosphatase [Arabidopsis thaliana]
-------MTIGSFFSSLL----------------------------FWRNSQDQEAQRGR
--------MQEIDLSV-----HTIKSHGGRVASK-HKHDWIILVI-LIAI-E---IG---
-LNLISPFYRYVG--KDMMT-----DLK--YPFKD-----NTVPIWSVPVYAVLLPIIVF
VCFYLK------------------------------------------------------
---------------RTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFP
DGKELYDA-----------------LGGVVCH-GK-----AAEVKEGHKSFPSGHTSWSF
AGLTFLSLYLSGKIKAFN-----------------------------NEGHVAKLCL-VI
FPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHE----EGWGPYA
YFKA--------------------------------------------------------
------------AQERGVP-----VTSSQNGDAL-----------RAMSLQMDSTSLENM
-------------------------------------ESGTSTAP-R
>gi|19112260|ref|NP_595468.1|	   279 residues, 50 /line  phosphatidic acid phosphatase [Schizosaccharomyces pombe 972h-]
-------MEAVGK-----------------------------------------------
---------------------------HVKLFWN-VYSDYAVLIA-ISLSY----FV---
FDVLMLPFTRQFS--LEDIT------IS--HPFALHEQ----VPTKYLGIICVFFPALVL
YGFGKL------------------------------------------------------
---------------RNNSLLFWKSLMGLLYSTMVCGLCVSLLKNAVGRPRPDFLARCQP
FES--------------TPKTG-L-VDVLSCS-VP---WSDKVLQDGFRSFPSGHTSFSF
AGLGFLAIFLAGQLKMFR-----------------------------NKTSSWKVVV-PL
VPLSIASWIGLSRSQDYRHHKEDIAVGALFGFAIAYVVYRQLFPPLDHH----NADILYV
Q-----------------------------------------------------------
-----------AELDEGYT-----N-----------------------------------
-------VH------------------------SAGNSSATNAEQMV
>gi|24652084|ref|NP_724787.1|	   379 residues, 50 /line  wunen CG8804-PB, isoform B [Drosophila melanogaster]
MPAVKIIMSTETSASETTPLRRSENETPDHKELAQSNSNSRQTTVNSNNNNYSNSVQVRL
QEQDRDSDSEQQQHTATITM-----DTNKRILCR-VGLDVLILLC-AGFPI----LL---
FFLLGEPYKRGFF--CDDES------LK--HPFHD-----STVRNWMLYFIGAVIPVGVI
FIVEVIISQNK----------AKQDNGNATSRRYVFMNY---------------------
-------------ELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQP
QMADGS------TCDDAINAGK--YIQEFTCK-GVG--SSARMLKEMRLSFPSGHSSFTF
FAMVYLALYLQARMTW-------------------------------RGSKLLRHLL-QF
LFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVAN-YVSDLFQK----PNTKPYL
ARTV--------------------------------------------------------
------------------------------------------------------------
-----QDMN------------------------ASPAQAITITT--N
>gi|24668567|ref|NP_649391.1|	   334 residues, 50 /line  CG11440-PA [Drosophila melanogaster]
------------------------------------------------------------
------------------------------------------------------------
----MHTFKRGFF--CSDLS------IR--YPYKD-----CTITVPMLLLMMLLLPMLFV
AVVEIMRICKR-------------------------------------------------
------------FRTRLYFRNLWRAEATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQP
RLDDGS------SCSDLQNAEL--YVEQFHCT-NNNL--STRQIRELHVSFPSAHSSLSF
YSMVLLALYVHGVWRGRG------------------------------GVRVLRHVL-QF
LLLMAALCVSLSRVADYWHHWSDVLAGALLGVTYAAITAAYVGNLLRRQ----TSSTGRI
PP-SLNYS--------HHLHHQL-----MA------------DNNNSTASAKVHFLAAAA
SASMTTTTPLDDIQDSDVE-----DSRDCRDSED-----------SHDSQDSHAENEDDN
EEV-YKSQM------------------------SRPVTPPTDLTHVV
>gi|24668581|ref|NP_649395.1|	   305 residues, 50 /line  CG11425-PA [Drosophila melanogaster]
------------------------------------------------------------
----------------------MSFNLSLRPPIR-LLVDLVLLGL-LIVLVEN---F---
RRLWGPPTKRGFF--CDDES------LM--YPYHE-----NTVSPTLLHWLGLYLPLISL
VVLESFLSHRK-------------------------------------------------
-----------DMAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSP
HFPDGS------SCLDESHRGALKYHTDYECR-PNLSQATEEMIRDVNVSFPSGHSAMAF
YGLVFVALHLRRRRWPL-------------------------------RGSLLSPVL-QL
ACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSALAVTRAAASEELQW----RCQDSLA
S-----------------------------------------------------------
------------AKQEAAV--------------V-----------DVADVKGGQQMPHD-
------------------------------------LSLVTCHIS-N
>gi|28571517|ref|NP_730949.2|	   363 residues, 50 /line  CG12746-PB, isoform B [Drosophila melanogaster]
-------MTASKEGQESRRTL----SDSSAEDVRNTGSRTRTNDDEMWRNELAMNTDSSS
--------VQPEKREE-----RSHRTGNSNAKLS-DAVDVVLRVL-LVITF----FK---
-LETMTAFKREIH--EEELW------LYK-NPRR-P----DIVRGGELLFWVIVAPFLVT
IAFYWY------------------------------------------------------
---------------TRDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRPDYFYRCFP
DGVMVLNTT-------SNGVDT--SILDFNCT-GL-----PGDINEGRKSFPSGHSSFAF
ASFGFIAYYIGAKLHAFD-----------------------SRG----RGHTWRLCI-AV
IPLFIALLVAVSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYPSIFCP----DAGIPLV
RWPSRE------------------------------------------------------
-GSQYQR--LSGKDDNGSR------------GPH-----------HLDGGDAVRRPLLA-
--------------------------------------DKEESKW-Y
>gi|33589398|gb|AAQ22466.1|	   340 residues, 50 /line  RE35738p [Drosophila melanogaster]
-------MRDAPEDQS------------------------VTVS--MPASASGSAAGSTG
--------PS----------------SDRRMTQR-LLVELLVVVV-LVIPI----CV---
YEFAVDPVRRGFF--CDDES------IS--YPFQD-----NTITPVMLGLIVGLLPALVM
VVVEYVSHLRA----------------GDISATVDLLGW---------------------
-------------RVSTWYVELGRQSTHFCFGLLLTFDATEVGKYTIGRLRPHFLAVCQP
QIADGS------MCSDPVNLHR--YMENYDCA-GEGF--TVEDVRQARLSFPSGHSSLAF
YAMIYVALYLQRKITW-------------------------------RGSKLSRHFV-QF
AVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALITAHYIARMFDDG---A-SNILSG
GLRRENT-----------------------------------------------------
----------------AAT-----LQEEVCPTTP-----------PPYSVNNS-------
------------------------------------FSEDQYCSK-V
>gi|45184740|ref|NP_982458.1|	   338 residues, 50 /line  AAL084Wp [Ashbya gossypii ATCC 10895]
-------MHSEGIYFRLGTKD--------HDQSLEGYAAPKLPY--TLHGESKMAV----
---------------DRVTLSIPKFKKQDLLEKW-RFTDVLFCIA-LVGA-----NV---
GVYFAKPFERQFT--INDIT------LS--HPFAQVQR----VNDAMLVVYSFVVPLAVI
IVVSLLFAD---------------------------------------------------
--------------PSHRYYLLYISVLGLFLSFLSDMIITNYIKNWIGRCRPDFLERCMP
REG--------------LEKDV-L-YGIEVCT-TT----DTDRLLEGFRTTPSGHSSESF
AGLGYLFLWLSGQLLTES-----------------------------PAVGAWRKAV-AF
IPLMAAAVIALSRTQDYRHHFVDVILGSILGMWIAWWSYRRNFPAIQSY----VPFKPLL
DNSDV-------------------------------------------------------
-----------------GL-----LNAPMLPRSV-----------DEEMAPLNTPSVQS-
---------------------------------------RSGTAQ-V
>gi|46110274|ref|XP_382195.1|	   369 residues, 50 /line  hypothetical protein FG02019.1 [Gibberella zeae PH-1]
-------MPLLPRIN-------------------------PDAA--ATPQSKRATLK---
-------------------------AFLRKWLKV-NYQDLLCMAF-VGALAYGIYHS---
PVIITRTFPITFD--ATSGDI-VYPQWA--YPDRG-----WIIPAWLSGLISIAIPIITY
IVAQI-------------------------------------------------------
--------------QIKSVWDASNAIIGTVWSVTLASLFQVTLKQLVGGFRPYFLDVCMP
DISLAKTHNKTGL-NGVGFYQI-M-YTTEICT-QP----DQSRIQNAITSFPSGHTTAAF
AGFGFLFLWLNAKLKVWA-----------------------DH-----KPAFWKLSL-TF
VPVLAAVLIAGSLTIDAAHNWYDILGGGFIGTIMAFASYRSTYASVWDW---RFNHLPLQ
ETESFRYG--------FDGDLDY-------------------------------------
-AAQTLSLAAGWGGKKVRL-----PESSSGPAIS-----------TESTLRSGAEEIENL
DAN-T----------------------------RRKRRGPVGEEA-V
>gi|46121977|ref|XP_385542.1|	   292 residues, 50 /line  hypothetical protein FG05366.1 [Gibberella zeae PH-1]
-------MRQM-------------------------------------------------
--------------------------ETHSLQTT-HAPDYVGFLF-LLAGW----IL---
TVLFVDPFHRMFF--INDLQ------IS--YPYAVHER----VPVFMNFVYALFIPLGVL
IAFNVAT-----------------------------------------------------
---------------RAPAAKHEVTYLSFLISIVLTSFITDIIKNAVGRPRPDLLDRCQP
AVG--------------TKANT-L-VTIDVCT-RE----DGHILQEGWRSFPSGHSSFSF
AGLGFLSLFLAGQLHVFR-----------------------YAA---GGRDLSRALV-CL
LPLIGAGMVAISRCEDYRHDVYDVCVGSALGMSIAYWSYRRHWPRLSSQ----KCDEPYP
RPGV-----------------DT-------------------------------------
-QPGWQR--FTDDEEAAR-----------------------------------GTDVGF-
------------------------------------EMDNLRGSR-R
>gi|50345080|ref|NP_001002211.1|	   266 residues, 50 /line  phosphatidic acid phosphatase type 2 domain containing 1B [Danio rerio]
------------------------------------------------------------
--------------------------MRKTIDNG-FIAEVAVRLL-LLGL-----FL---
VTEELPPFSREIQ--PEELW------LYKFHPVK-K----DRVPTRFMFAIALFTPLLVI
FLFAFLK-----------------------------------------------------
---------------QGGKGDLKEASLAVTLTLVLNGVFTNAVKLAVGRPRPDFFYRCFP
DGQMNPE---------------------LHCS-G-----DPDVVMEGRKSFPSGHSSFAF
AGLGFTALYVAGKLHCFS-----------------------TAG----QGKAWRLCA-FL
TPLLFAILIALSRTCDYKHHWQDVLVGSLLGLVFSYLCYRQHYPALNEP----DCHRPLR
M-----------------------------------------------------------
------------RETALPA-----------------------------------------
----A----------------------------ERKQANPGYLLP-L
>gi|50424917|ref|XP_461050.1|	   309 residues, 50 /line  hypothetical protein DEHA0F17182g [Debaryomyces hansenii CBS767]
-------MDNVKKKVY---------------------------------------SALNY
--------FHTDDDFNRVTFGLKRNALSARLVRW-RFADLVLLGV-LCVL-Y----I---
VTYKIEPFQRQFF--INDLT------IS--HPFAESER----VTNGALFFYSVWEPIMVI
GVIGLIMTK---------------------------------------------------
--------------PENKIYVTYVSILGLCISCFTTSVVTDVLKNLIGRHRPDFLARCVP
RSD--------------APLNV-MVFAKDVCT-TD----NLDLLKDGFRTTPSGHSSISF
SGLVYLSLWLSGQLVIMN-----------------------------ENLGYWRSIL-AW
IPTLQCTYIALSRTEDYRHHFVDVIIGSLIGLGMACWAYRRLFPHITHP----KSYEPYI
I-----------------------------------------------------------
-----------ISEEEDND-----------------------------------------
NPD-T----------------------------QYNRINQDESLS-V
>gi|50546837|ref|XP_500888.1|	   278 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
------------------------------------------------------------
-----------------------MLSSSSTLKQY-HVIEWITAFT-LIFL-W---Y----
VSESAAPFTREFI--ISDPT------IN--HSHVTVER----VSSEACILYTIIIPFFVL
IGLSAIMAPR--------------------------------------------------
--------------PQDRLKFMSITLSTFLVAAFFNGFITNFLKIYMGRHRPDFIARCEP
SKR--------------APIDK-Y-VTIEVCT-GDM-----DTILEGMKSTPSGHSSTAF
VGMTFFCLWVYGQINAYK-----------------------TYG-----SKASKLLL-AF
FPLLLAIYIALSRTEDYRHHFVDIVLGSLLGMTIAYYFYRREFPRTTSK----TSHIPYC
LGSE--------------------------------------------------------
----------------------------GADDDH-----------HYDRV----DDVQL-
------------------------------------------ENQ-V
>gi|54696046|gb|AAV38395.1|	   312 residues, 50 /line  phosphatidic acid phosphatase type 2B [synthetic construct]
-------MQNYKYDNA------------------------IVPE--SKNGGSPALNNNPR
--------RSGSKRVL-----------------L-ICLDLFCLFM-AGLPFLI---I---
ETSTIKPYHRGFY--CNDES------IK--YPLKTGET----INDAVLCAVGIVIAILAI
ITGEFYRIYYLKKS----------------------------------------------
----------RSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNP
DFSQINC------------SEG--YIQNYRCR-GD-----DSKVQEARKSFFSGHASFSM
YTMLYLVLYLQARFTW-------------------------------RGARLLRPLL-QF
TLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVF-FVSDLFKT----KTTLSLP
APA---------------------------------------------------------
-----------IRKEILSP-----------------------------------------
----V----------------------------DIIDRNNHHNMM-L
>gi|58259405|ref|XP_567115.1|	   354 residues, 50 /line  phospholipid metabolism-related protein [Cryptococcus neoformans var. neoformans JEC21]
-------MSSVADAV----RF----CFPTAPIGPEAAI--DFPL--YARNESQLAQGKVR
--------HEEEERVV-----SPVQATFKTICAS-YAPDWIIVFV-LWAV-L---VI---
-LDRSGGHKREFS--LNDVS------IQ--HSFAEHER----VPPVLLVLFSIVVPLLVL
VPLSSLI-----------------------------------------------------
---------------ARNAWDTHNSVLGLLMSYTMTGVVTQIIKMSVGRPRPDLIARCMP
IEGAMDH-----------PVFG-L-TNVSICT-NT----DAFILDDGFKSFPSGHSSMSF
AGLGFLSLYLAGKMHLWD-----------------------------NGGHRTRAWA-AL
SPLLGATMVAISRTEDNRHHWQDVLIGSILGLFIAWVAYRTYYPPLSHN----QCHLPLA
PRTDP-------------------------------------------------------
--DNYQD--FPLDDEEQGR-----------GGPR-----------DRVRL--LSEETDGR
AGE-E--------------------------------QVAWQATG-R
>gi|6320711|ref|NP_010791.1|	   274 residues, 50 /line  Lipid phosphate phosphatase, catalyzes Mg(2+)-independent dephosphorylation of phosphatidic acid (PA), lysophosphatidic acid, and diacylglycerol pyrophosphate; involved in control of the cellular levels of phosphatidylinositol and PA [Saccharomyces cerevisiae]
----------------------------------------------------MIS-----
---------------------VMADEKHKEYFKL-YYFQYMIIGL-CTILFLY--SE---
ISLVPRGQNIEFS--LDDPS------IS--KRYVPNEL----VGPLECLILSVGLSNMVV
FWTCMF-------------------------------DKDLLKKNRVKRLR---------
---------ERPDGISNDFHFMHTSILCLMLIISINAALTGALKLIIGNLRPDFVDRCIP
DLQKMS------------DSDS-LVFGLDICK-QT----NKWILYEGLKSTPSGHSSFIV
STMGFTYLW----QRVFT-----------------------TRN---TRSCIW-------
CPL-LALVVMVSRVIDHRHHWYDVVSGAVLAFLVIYCCWKWTFTNLAKR----D------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------ILPSPVS--V
>gi|66542055|ref|XP_623887.1|	   268 residues, 50 /line  PREDICTED: similar to phosphatidic acid phosphatase type 2 domain containing 1B [Apis mellifera]
-------MSII-------------------------------------------------
--------------------------YGKDFLVG-YLFDILLRIV-LVGL-F---IE---
-LEKAEPFTRIIH--EDELW-----LYK--KPRTE-----SYVPTTILWPLVFTMPVIVI
FCVFLV------------------------------------------------------
---------------YKDKTDIYQAILAVTLALGFNGVITDIIKLIVGRPRPDFFWRCFP
DGQTNPD---------------------FKCN-G-----NPVVIKDGKKSFPSGHSSFAF
TSFGFIALYIAGKLHTFS-----------------------LG-----KGQLWKLFA-FV
LPICIALLIALSRTFDYHHHWQDVVVGSIIGYFLAYMCYRYYYPPLDSQ----VCHKPYA
A-----------------------------------------------------------
-----------LNQIHCC------------------------------------------
--V-G----------------------------EMLSQLPVHGED-S
>gi|66809727|ref|XP_638587.1|	   271 residues, 50 /line  phosphoesterase, PA-phosphatase related-family protein [Dictyostelium discoideum AX4]
-------MIHRVSFYG--------------------------------------------
--------------------------KTTWFTKQ-HLIDWFLCLG-IFVIES---VL---
FNFVIPPFKRYEP--ESNISTNTFQLVQ--YPLLP-----DIVPVWLLMLIALGLPMVVF
IGYYI-------------------------------------------------------
--------------KNRNSHDFHHAALGLFQAFTITMLFTDILKVSAGRYRPDYGARVAT
---------------------------------GI-----EAVIREGRVSFPSGHSSVSF
CGMTFLSFYLCGKTKVFL-----------------------KD-----GGNILKALV-CL
CPFMISALVAVSRTVDYHHDFSDILAGSVIGLSIGVFVYFMNFNSLFSK----ECSLPKN
R-----------------------------------------------------------
-----------INPHYAR-----------------------------------------D
GLL-S----------------------------AEYQSLSISS-S-L
>gi|66824401|ref|XP_645555.1|	   366 residues, 50 /line  phosphoesterase, PA-phosphatase related-family protein [Dictyostelium discoideum AX4]
-------MENSGLLFN-------------NDETIINKKIKKIIY--ENQYDKPLF-----
---------------------YDIDLRKNNKKLI-YLLDWFCVVV-LLVI-G---SI---
LLLKVPVRGRLFR--LNDES------IS--YPKLE-----EIIPLGLLIPLVTAVPFAMI
LLISIIF-----------------------------------------------------
---------------KRDINDFHHSLLGFLQSISVTILLTGSFKVFIGGLRPSFLEFCKP
TKESIVAG-----NPPVGYGAI-Y-YDRSICT-ES-----EFIVNDGLSAYPSGHSSIAA
SCFGFLALYLLARLKCFD-----------------------NR------GHIIIYLL-II
GCLITAGLIGISRVADYRHTFLNVLAGWSIGLLISLSCYRLNFSSLFGR----DNHISIH
SHWLTYWD--------YHNNNNN-------------------------------------
-SNSNNN--NNNNNNNNNN-----NNNNNNNNNN-----------KKDNINNNSTKTQNN
FES-Y----------------------------QSPNGIPLNELQ-N
>gi|67467281|ref|XP_649759.1|	   255 residues, 50 /line  lipid phosphatase [Entamoeba histolytica HM-1:IMSS]
-------MSI-------------------------------------------WT-----
---------------------KIKHSFSLLDISE-IFSDVIVFGI--SLL-T---IV---
ITLFCSPNQMVIPNEKNN--V----NVD--YLYVEKET----IPFWLCALISYVPPLLLI
LLFSLF------------------------------------------------------
---------------KKSSKFLFYSLFCLILCISSNIAITNCAKLFAGRPRPHFYARLSE
H---------------------------------------PEQVKSVYQSFPSGHSSSIS
NGMTFCTLFLAGQMKIFA-----------------------------SSQESWKLLV-VS
LPSIVAIFIMITRTRDYYHNFSDIIGGGIIGLFTAFIFYCNKFNSLSSD----HSDD---
------------------------------------------------------------
------------------------------LKIT-----------SISQLED-QTDI---
-------------------------------------------FD-V
>gi|67467677|ref|XP_649928.1|	   250 residues, 50 /line  hypothetical protein 259.t00003 [Entamoeba histolytica HM-1:IMSS]
-------MNKVL------------------------------------------------
-----------------------------NILFQ-IGGDIIYIIV-TGAV-A---AV---
L-TFIDGFHMEVPGGENN--V----NVL--YPYRD-----STFSEAVAGIVIYASTILII
IAFQI-------------------------------------------------------
--------------KRLSFKHTIFTFIGLGASVTTWLMFVQGGKIYAGRPRPNMYALVA-
----------------------------------------QGKEKDAWKSFPSGHSAASF
CGYTYLSLYIAGELRIFS-----------------------------DRPELWRMIP-VI
IPMFLAGIIVLTRTRDYYHNFSDVLAGSIIGILSACIGYFSKFESLFSP----KAGE---
------------------------------------------------------------
------------------------------IRLT-----------CRNHKKN-NEDIPD-
---------------------------------------EEMAEM-S
>gi|67469998|ref|XP_650970.1|	   245 residues, 50 /line  phosphatidic acid phosphatase [Entamoeba histolytica HM-1:IMSS]
----------------------------------------------------MLN-----
---------------------FRSIK--QQCTKT-LVIEFSIGVI-LFVG-G---I----
LLKYLPSYQMDIP--LERKNF----NVT--YPLVS-----ETFPFLFCCIFSWCIPVIVI
FYFAQ-------------------------------------------------------
--------------KRNSSKYFITSITSFFFAVSLCLFLTNAFKLFAGKPRPNYYSLIDN
-----------------------------------------KKASKVYQSFPSGHSSTTF
NGMMFLTLLLCGEYKIFN-----------------------------GEGSILKLVG-CC
LPLLFGCIVAISRVRDYFHGYDDIIAGSLLGCLTAVLCYVLKFKVLWST----NSGE---
------------------------------------------------------------
------------------------------IETE-----------EYKEFDD--------
------------------------------------------NYI-V
>gi|67473662|ref|XP_652582.1|	   259 residues, 50 /line  lipid phosphatase [Entamoeba histolytica HM-1:IMSS]
-------MDIL------------------------------------------QQ-----
---------------------LYLPLLHKSVLLN-VIYDIVVIVI-FVII-S---I----
VCVFVTPHHMDIP--KDRENV----NVL--YPLYS-----SSVPTWACIIIGYIPPVLTI
LLITI-------------------------------------------------------
--------------KKKSSLFLLFSLLSLGLSASMCLGVTNMGKIFAGRPRPHFYARIDA
K---------------------------------------PNEINDAYMSFPSGHSSAIF
NGMTFLALLIAGQIHAFS-----------------------IAS-----HESWRMLI-VL
LPFIIAGTVAISRTRDYHHNFSDIIAGSLIGIFFALLSYCSKFKRLSDE----HSDD---
------------------------------------------------------------
------------------------------LKIE-----------DVVKSQE-PFPLED-
------------------------------------------EEK-Q
>gi|67478931|ref|XP_654847.1|	   243 residues, 50 /line  lipid phosphatase [Entamoeba histolytica HM-1:IMSS]
-------MWKEQW-----------------------------------------------
----------------------------ITFLKK-RKIDIIITFI-VFVL-S---KL---
F-GLLPPFKMETP--HNHPS------YH--YSKHE-----NTFTRNMTITIDFFIPLICI
ILLCL-------------------------------------------------------
--------------KNHYISGLFNSILSFIFNDSLNGTITQLYKIFAGRPRPFYFNGCNP
SL--------------------------YTCT----------------KSFPSGHSSFSM
AGLLFLSLFLYFYFKKSN-----------------------IHL-----NSLSSVFF-CG
LPSFLAIIIAVTRTRDHYHHFSDILGGSILGGFVAIISFFSTFQRFYTE----EED----
------------------------------------------------------------
-----------------ET-----------VDYE--------------IIN--NKTVLL-
-------------------------------------------EE-E
>gi|68484435|ref|XP_713828.1|	   261 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Candida albicans SC5314]
------------------------------------------------------------
---------------------MLQIYFTSSKFRK-FIPDWIVVIL-LVII-F---FQ---
VTEVAQPFARQFY--INDPT------IS--HPFATQEQ----VTDNQLYLYSVLIPSLII
SLISLYLGES--------------------------------------------------
--------------NFEKLHNLQVSCLGLWLSVCVTSVLTDVLKCWISNPRPDFLERCGP
QKG--------------TPENK-L-VGIEVCT-SPL---GPMYLSDGLKSTPSGHSSMAF
SGLLYLSLWLVGQFKLIQ-----------------------KR------KSIGYVLI-AG
LPILVAAYIALSRTQDYRHHFFDIGFGSAIGIVFAVIFYYKYFNSLSDE----SCNVP--
------------------------------------------------------------
------------------------------IDYK--------------------------
----------------------------------------------D
>gi|68486075|ref|XP_713054.1|	   284 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Candida albicans SC5314]
-------MTFL------------------NPSSIVKYTQS--------------------
-----------------------------NQFHD-FIPDWIVATV-TVLF-F---FS---
VAETALPFQRQFS--LDDLT------IS--HPFAIKER----VSGILCIEIAAFVPLFVI
LTSLLVKYQQG-------------------------------------------------
----------AFSSHQQALHCLQISVLGLIISLSLNGVITDILKIWIARPRPDFLERCGP
APG--------------TPLHE-L-VDVNVCT-APL---GKALLIDGMKSTPSGHSSISF
GGLFYLTLWLLGQFKLFQ-----------------------NRE---SPQYVYKYFL-AF
SPLSLATYIALSRTQDYRHHFTDIVLGGAIGISFAWWSYHHYFNKLVSE----ESHKP--
------------------------------------------------------------
------------------------------IDSE-----------TLTE-----------
-----------------------------------------SLLP-H
>gi|68487344|ref|XP_712443.1|	   362 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Candida albicans SC5314]
-------MKREIFFSFKWPFF----LGLCSLSCLCRCKKN--TQ--IMVTDWVFT-----
---------------------INRLQFSGLTTIS-YIFDFLFYLT-ILIL-S---AT---
LGRTLPPRYHEFS--LYDIT------LR--YTHFPEAT--ILVRVWLLVLISAGIPLTQF
LLFSIFVVLP--------------------------------------------------
--------------IRRRIWDFLAGCLCLLGAMATQLLVTVLLKNIIGLPRPDFIDRCEP
MIQNIPLTS--------------L-STVAICT-QP----DWNLVQEGFRTFPSGHSATVF
TGMTIAALNFAARLQTFD-----------------------------NRNNSFKVFI-TI
SPWLIAACVASTRVSDNRHFLKDIIAGAFIGTCIGSVFYLQYHPSIFNL----ANAGRS-
-FPPRRFG--------IQRFFQN-------------------------------------
-IGGFWK--LDGESSD-RA-----------LGAE-----------DLEKLS--NEQLGQP
ARI-T----------------------------SMADNIEVVNKL-L
>gi|70995150|ref|XP_752340.1|	   353 residues, 50 /line  PAP2 domain protein [Aspergillus fumigatus Af293]
---------------------------------------------------MRPA-----
---------------------LSRIP--LRLVFS-YILDWIFIVI-VAVI-G---FG---
F-HKVQPNHRPFS--LTDPS------IS--FPYTEHET----VSTAVLMVVALIAPAVII
VITALLIPMS---------TKDQNVPRSSL------------------------------
--------------WRYKLWEWNAGWMGLAVACAWAWMATEGLKDLYGRPRPDMLARCNP
DLSNIATYAVGGLGENLAGAPT-M-VTWKICQ-NK----SKVLANDGFASFPSGHSSFSF
AGLTYLTLWLCSKLSIAFPYLGHS--LLNQNPIGPINGSIRKRG---AAPPVYMLVV-AF
VPIAVASFIGASRWFDYRHHAFDILFGSIMGAIFAWIGFRMYHLPITRG----EGWSWA-
-ARSRRH-----------AFFKS-------------------------------------
-P----R--FPSEADERRP-----------IDTH-----------DTQKTT--RQDIDV-
--------------------------------------ERAAENL-V
>gi|71411248|ref|XP_807881.1|	   317 residues, 50 /line  phosphatidic acid phosphatase protein [Trypanosoma cruzi strain CL Brener]
-------MSAC--VRVVVVFF----FLCVCVSFSLFFVPF--SP--LWGVSVGMD-----
---------------------INRLV--LYWKNY-QLLDFVLGLF-LLIF-S---SI---
LVFVVPPYCRPFS--WNDPT------IN--YPYVTNVA----FPAWSLLLMFVLALIFY-
--VAVLTSLGG-------------------------------------------------
--------------------PIWVWLKAQTLAVISQLVVVNLLKIYAGRIRPDYLERLRS
LGIDENTYAKIDV------KYM-S-STEFYCKLGV----EHRVLREGRLSFPSGHSSTSF
SVLAFMSLFLFAHTQPSS-----------------------------RGGSFLRLIL-SL
SPLAIAFLCAVSRTRDYWHHFDDIVAGALIGTVSALMCFYNAFYITEDG----RCVARV-
------------------------------------------------------------
---------IELAQQEERA-----------GEIS-----------NG-------------
--------------------------------------RPLSVVV-A
>gi|71660303|ref|XP_821869.1|	   315 residues, 50 /line  phosphatidic acid phosphatase [Trypanosoma cruzi strain CL Brener]
----------------------------------------------------MLP-----
---------------------YQKVL--KVLQKL-RIVDYLLCVF-LCTA-A---LT---
IGKKVRPHCRQFS--WQDAT------IG--HTYAGAGL----FPSWSLAPIAILPALIYF
V-VELIRALL-----WRPDTRPSHGPSTSLDLVTNALETRNSERMNMRRCHTEEADGGTV
INTSDGEEAGGNARWWLFLEKLNHWLLAQAFSVTLSMFIVDITKLYAGRLRPDFLARLEN
EGYSEKST-GVD-----------------WC----------KVAREGRLSFPSGHAAISF
SSIVTLVLFFVGHLQVFY------------------------------FASPLRLFL-SM
LPLILPIVVAVSRTRDNRHHFSDVLAGGIIGTGCALLSVTVLFRVVKRN----GMFLPR-
------------------------------------------------------------
----------RQD-----------------------------------------------
-----------------------------------------YASK-R
>gi|71749074|ref|XP_827876.1|	   332 residues, 50 /line  phosphatidic acid phosphatase [Trypanosoma brucei TREU927]
-------MATG--G--------------------------------------RSS-----
---------------------FAVYL--YYAKVL-RLLDYLVAFC-FGAT-G---FL---
LGRLIRPYCRTFS--WDDLS------IN--NSFAEKET----FPDWSLVVMALVSCLFIF
I-IEKMRERYSPVGEWYMDEQLPEPSSNSITSSTNVLSEERAANR--GGASVRERNGLEN
LPPAPSFERK-VQRKFIVDQVINLWILSVVFAFFFSLGIVDVLKIYAGRLRPDFLDRLRR
EGFNATSP-PSN-----------------AC----------SLAREGRLSFPSGHSSCAF
AAFTPLTMYFLGLSRAFN------------------------------SGPVWRIIL-SM
FPIYLAICVAASRTRDNRHHFSDILGGSVIGLVIGAFSVNIFFRVRSGE----GYLVPR-
------------------------------------------------------------
----------RLEPPRR----------------R-----------SG-------------
--------------------------------------SPNDNDT-V
>gi|125809222|ref|XP_692261.2|	   365 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
-------MTLRQT--------LGDNNAPYTEIWDP-----------------------YV
CKDKRFFGAAPN--------------HSALRLSE-LNNDSVVCV-SVAMPF----II---
MTIMYRPYHRGVY--CNDET------IQ--YPYRP-----DTISHKMMAAVTISCSVIII
ISGEAYLVYTKRLY----------------------------------------------
----------SNSDFNQYAAALYKVVGTFLFGACVSQSLTDMAKYTIGRLRPNFMSVCAP
AVCEG-------------------YMLEINCT-GN-----ARNVTESRLSFYSGHSSFGM
YCMLFLALYVQARLAS-------------------------------KWARLLRPTI-QF
FLVAFAIYVGYTRVSDYKHHWSDVVVGLLQGALVAVLTVRYISDFFKER----PPRCPDV
ENAENA--------------------------DVERKPSLQIADTDRNNYYPISRPMRLY
RLSLFCTLIYSKCADHLT---------------------------PNDTVFIVSEHKDEL
QGE------------------------------------LDKLKTTA

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.