FANDOM


>gi|15226185|ref|NP_178224.1|	   391 residues, 50 /line  fructose-bisphosphate aldolase, putative [Arabidopsis thaliana]
-------MASASFVKPNTLSSPWIGQRSFAHTSASSSPPPRVS-----------------
--FAIRAGAYSDELVKTAKSIASPG----------RGILAIDESNATCGKRLASIGLDNT
------------------------------------------------------------
-----------------------------------EDNRQA-------------------
----YRQL--------LLTTPGLGDYISGS------ILFEE------TL-YQSTKDGKT-
------------------------------------------------------------
------------------------------------------------------------
------------------------FVDCLRDANIVPGIKVDKGLSPLA------------
--GSNEESWCQGLDGLASRS---------------------------AEYYKQGARFAKW
RTVVSV-----------PCGP-SALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDH
P-----IERTLEVAE-KVWSEVFFYLA---QNNVMFEGILLKPSMVTPGAEHKNKASPET
VADFTLTMLKRRVPPAVPGIMFLSGGQSEAE-------------ATLNLNAMNQS-----
----PNPWHVSF-S-----------------YARALQNSVLRTWQGKPEKIEASQKALLV
R--AKA-----NSLA---------------------------------------------
-----------------------------------------------------------Q
LGKYSAEGENEDA----------------------------------KKGMFVKGYT-Y>gi|108881118|gb|EAT45343.1|	   306 residues, 50 /line  phosphatidic acid phosphatase [Aedes aegypti]
MNKNGSVT------TPATPVSKSTSING--------------------------------
-------------------------NGVASANINL---------------------FQEI
------------------------------------------------------------
-----------------------------------VIRLML-------------------
----FGLY---------FYFELKEAFVRVI------HPEEM-------------------
------------------------------------------------------------
------------------------------------------------------------
-------------WLYKNPISPSYVPLALLYPAVFGLVGLVIIGYFI-------------
-------------------------------------------------------RSRDF
QDFKCA-----------WLGFSLACTLNGAITDVIKVSVGRPRPDFFYRCFPDGQM----
----------------NEDMACT-G-----DAWTVKDGRKSFPS----------------
----------GHSSFAFAALGYLAWYLFAKLHVFTE---------------------RG-
---RGQTWRLLA-SGGPLFAALMVAISRTCDYHHHWQDVTVGSLIGLTVGYLSYRQYYPP
L--DSR-----HCYLPYSSEVISP------------------------------------
----------------------NSNRKSVSKRDQVPDESESDTKML--------------
-----------------------------------------------LGGEEKESKW-T
>gi|111069427|gb|EAT90547.1|	   370 residues, 50 /line  hypothetical protein SNOG_02335 [Phaeosphaeria nodorum SN15]
MPSTSDA------AKPAASSAELAHVTSRQ------------------------------
--PQSTSNRSTSPSSLKHDLESANPNPSHYNHWLPGFHNPPLFLT--FLRHN----WYDI
------------------------------------------------------------
-----------------------------------GTQLLC-------------------
----LLTSLLL-------YAFCQPILPRYFPLFRGVERTSWGM----KH-SQPYLS----
------------------------------------------------------------
------------------------------------------------------------
----------------------EYVSTITSAIISFAVPAAIMGAIALW------------
-------------------------------------------------------GTRGF
GDGNAA-----------LIGLGYALSTATLFQSFIKIFIGGLRPHFLTICNPRIPPSLPG
----LSTLRDGDLHFYTASQVCR-G-----DANKVREAQMSFPS----------------
----------GHSCAAFAGFGFLALYLNAKFKVLSRGGHFRDYYGDKAWERSERSERGDG
-MERVHHWKLVL-FVAPWCIAILFALSKIRDAWHHPVDVVFGALVGTLFAHMAYKMAYRS
V--YDS----RTNHIPLEG-----------------------------------------
-----------------------------------------DGGDF--------------
---------------------------------------------------NKEEVKDK
>gi|113475370|ref|YP_721431.1|	   346 residues, 50 /line  Fructose-bisphosphate aldolase [Trichodesmium erythraeum IMS101]
------------------------------------------------------------
------MSPYLEELKVTAQAMVAKG----------KGILAMDESNGTCNKRFEKLGIPTT
EEYRQAYRQLILTTPDLSNYISGPILYDETIRQSTTEGVPFLKVITDAGMIPGIKVDTGA
KNLANHPNEKVTEGLDGLGERIAEYYQMGARFAKWRAVITIGDGIPSRACIEANAHGLAR
YAALCQEGGLVPIVEPEVLIDGNHTLERCF------EVTDE------TL-HTVFNHLYTQ
GVAFDQMILKPSMVIPGKDCPTQVSVEAVAEATINCLLKNVPVTVAGIAFLSGGQSIEQS
SAHLNAMNALFGSRCPWPVTFSYARAIQQPALDYWSGDSARVAEAQQKLLARAKCNSAAS
VGEYSASMDETPVLVYRNPRTDSYVPLTMLWPIVLGVPGLAFTLHYL-------------
-------------------------------------------------------RTRDR
QELRCT-----------VLAFTLGLGLNGVITNTVKIAVGRPRPDFFWRCFPDGV-----
---------------LNDELHCT-GK----DMRALIDGRKSFPS----------------
----------GHSSFAFVGLGFLTWYLIGKLHLMNE---------------------RG-
---RGRSVRVIA-AGLPLFAATMIAISRTCDYHHHWQDVTVGSLIGIVLSYLCYRQYFPA
F-----------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------
>gi|116056575|emb|CAL52864.1|	   291 residues, 50 /line  putative phosphatidic acid phosphatase (ISS) [Ostreococcus tauri]
-------MASSSGERGETA-----------------------------------------
---------------------------REAREE--REETSNLMTRRARARTL----AVDA
------------------------------------------------------------
-----------------------------------VAFGLM-------------------
----FSLGTWL---------EVAEPNQKY-------IQQEM----LWRY-SYPHKE----
------------------------------------------------------------
------------------------------------------------------------
----------------------NTVPTVVVPIISFLIPLACMLAVPRS------------
--------------------------------------------------------WNPH
VRKERA-----------IGGLTVSVGLTWVVTCAMKNIIGNIRPDFVARCWPDGN-----
----------IVWAS-AGVPKCS-GAN-----DDVQQGRRSFPS----------------
----------GHTSMSFSGLFYCSLYLAAWFRVGRE---------------------ERK
FRRWEAVWKLIV-VLGPTLLAMFVGLTRIRDYWHHWEDVLVGATLGTTFAYVSWVYKKPY
V--RPSGFGFNENYT---------------------------------------------
-------------------------------------PLGRSAEDF--------------
-------------------------------------------------------SLVD
>gi|116505206|gb|EAU88101.1|	   260 residues, 50 /line  hypothetical protein CC1G_11524 [Coprinopsis cinerea okayama7#130]
-------MEKGPAEMPSRDHEPAASVSSQQ------------------------------
---------------------------PLAQQPRAQQTQAFNLVV--WLKLH----GVDI
------------------------------------------------------------
-----------------------------------ITMACM-------------------
----GAVALGV---------HLAPAPSNDFPI----YNVDG------SI-MYPEYSFPR-
------------------------------------------------------------
------------------------------------------------------------
--------------------KTQIVPIWASALMAIFIPLVFFVLAQA-------------
-------------------------------------------------------RRQSV
DDLLTT-----------FLGLIKSVVSSSVFQVIIKATIGGLRPHFYDVCKPLVSPGDAP
SGIG------FNDII-YDPSICT-GD-----SEHIKDALRTMPS----------------
----------GHSAAAWSGLMFLAFYLNAQLKVISG---------------------N--
---NPAYWKSVL-FLAPILGAFLLSAYL----------ITIGQ-----------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------T
>gi|119194029|ref|XP_001247618.1|	   265 residues, 50 /line  hypothetical protein CIMG_01389 [Coccidioides immitis RS]
MAQNDLP-------LHGNRKPSGISA----------------------------------
----------------------------------RP-GCLGAVARF-WYRSY----AADY
------------------------------------------------------------
-----------------------------------ISLAII-------------------
----TAGW--------FIIQIFVEPFHRMF------SLENG------SI-QFPFAVVER-
------------------------------------------------------------
------------------------------------------------------------
------------------------V-----------------------------------
------------------------------------------------------------
------------------------------PVDVVKNAVGRPRPDLISRCKPEKG-----
---------TPAHTL-VSFNVCL-ET----DHHILHEGWRSFPS----------------
----------GHSSFAFGGLGYLSLFFAGQLHVFRP------------------------
---RSGLARFLF-SGAPLLGALMIAMSRLADYRHDVYDVTVGSLLGLFTAYFTYRRYYPS
L--KSI-----DCDTPYSRPSGGYV-----------------------------------
--AVSGVNRGLG------------------DEE---QPCNSPRP----------------
-------------------------------------------EYSGAEYQM------Q
>gi|121699191|ref|XP_001267939.1|	   309 residues, 50 /line  PAP2 domain protein [Aspergillus clavatus NRRL 1]
MPRNGSA----------------TGP----------------------------------
----------------------------------KPTGVPGILARFYQRSYP----AVDY
------------------------------------------------------------
-----------------------------------VALACL-------------------
----AGIW--------VMIQLFVDPFHRMF------SLDNR------SI-QYPFAVVER-
------------------------------------------------------------
------------------------------------------------------------
------------------------VPVLWSIIYAGLIPLLVIICWAAV------------
-------------------------------------------------------FRPKP
YQVQLT-----------VLGLLVALMLTSLITDIIKNAVGRPRPDLVSRCVPKKG-----
---------TPGNAL-VAWTVCT-QT----NNHILQEGWRSFPS----------------
----------GHSSFSFAGLGYLSMFFSGQMHVFRP------------------------
---RADLWRCIL-ALIPMLGALMIAISRLEDYRHDVYDVTCGSLLGLVVAHFSYRRYYPA
L--RSA-----ACDTPHDFTDS--P-----------------------------------
--GPNGFSKLPA------------------DEE---QQIHGRSW----------------
-------------------------------------------EAETYPLEELPPHNGR
>gi|123471801|ref|XP_001319098.1|	   253 residues, 50 /line  PAP2 superfamily protein [Trichomonas vaginalis G3]
MIEIDER-----------------------------------------------------
-----------------------------------------DPLWKRILYFI---DYQDM
------------------------------------------------------------
-----------------------------------IISILA-------------------
----LAVW---------LGLSTIEPNYLYI------PENDG------DS-NYPMKK----
------------------------------------------------------------
------------------------------------------------------------
----------------------SQIPFLLLSFIVFGGFNLIFIGLYFL--ARRYP-----
-------------------------------------------------------KYFCR
FDLFPV-----------AWGLVFAISMSNIFVNVPKSYVGRARPDIYARCGVK-------
-----------------NLTECP--------QKILKEEHKSWPS----------------
----------GHSSTAMSATIYMAAFFIKFLYA---------------------------
-----KPYAIIF-SALFALFGIYVGATRIVDFRHHPDDVLAGLFIGFIAAYIVWENLSTK
I--FIE-SNQKDETLP--------------------------------------------
------------------------------------------------------------
----------------------------------------------------LPQTITQ
>gi|123503270|ref|XP_001328470.1|	   250 residues, 50 /line  PAP2 superfamily protein [Trichomonas vaginalis G3]
MKLFKTLG----------------------------------------------------
---------------------------------------SEFTYFWKSFLEN----LPEW
------------------------------------------------------------
-----------------------------------FATICL-------------------
----GLVS--------VVIALMIEPKERIA------FFENF------NE-RYPYSG----
------------------------------------------------------------
------------------------------------------------------------
----------------------ETLGIPIVALLIIILPCAVLGILTLA------------
--------------------------------------------------------YPRR
MELNLA-----------GMSLAQSLCLTLLITEALKVTVARPRPNFFSYCQYDQN-----
------------------AKKCT-GP-----SSHKRDARLSFPS----------------
----------GHASNAFATGTWMCLFLGEFF---HN------------------------
---SEEIWWIIL-RFIPIMIATFIAATRITDYMHHVSDVISGVVIGIGCSTIIFRAQSNR
I--FMT-----NHRREEP------------------------------------------
------------------------------------------------------------
-------------------------------------------------------VSLL
>gi|125828555|ref|XP_697507.2|	   303 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
---------MEVGA-----SSKWVGH----------------------------------
-------------------------------------ELQKVMQLYWGKYSTLLTFVLFL
------------------------------------------------------------
----------------------------------SLLFLLV-------------------
----GLPF--------AILTIQHKSFKRGF------FCNDD------SI-KYPYKE----
------------------------------------------------------------
------------------------------------------------------------
----------------------DTISYQLLGGVMIPVTLLTMIIGECLSVYLNRI-----
--------------------------------------------------KSNSFCNGYV
ACVYKA-----------IGTFVFGAAISQSLTDIAKYSIGRLRPHFLDVCKPDWSKINCT
-----------AGA-YIEDFVCT-GK-----ESVVNEGRLSFYS----------------
----------GHSSFSMYCMLFLALYLQARMQAE--------------------------
---WARLLRPTL-QFFLIAASVYTGLSRVSDYKHHWSDVLTGLIQGAIVALLVVFF-VSD
F--FKK-KVEPQKETEIPH-----------------------------------------
------------------------------------------------------TTLQET
PTNGNHYDN------------------------------------------------PN
>gi|126137015|ref|XP_001385031.1|	   361 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Pichia stipitis CBS 6054]
-------MDIHDW-----------------------------------------------
-----------------------------------SFSYMKHDISGLSFLSY----VVDW
------------------------------------------------------------
-----------------------------------IVYVAI-------------------
----LTVA--------ILFGSVIPPWYHEF------LTNDI------SL-MYSHVSEED-
------------------------------------------------------------
------------------------------------------------------------
----------------------TVIPINILLVITVVLPLLQFVLCALY---SPSS-----
-------------------------------------------------------GTRRA
WDIFAG-----------LTCLCGSMATQLMITCVLKNICGLPRPDLLSRCQADIDLV---
----------PDEGL-LTVAVCT-ND----NIFLLQEGFRSFPS----------------
----------GHLSTVFCGMVVTSLNIAGKFQVFDK------------------------
---RAMSTKIFL-TIVPIIVACFVACTRISDNRHFLRDVVGGAIIGSSAAVWFYSQCFPS
V--FHL-----ENAGRA--YPPRRFG--------VAAFFNNVGGFWAL-----------R
EKIPGSFMDRILNTRSTLELLKNSDPIVN-GEIDNPD---------------------EL
VNIQSNIRFLNRIAPIFK--------------------------NRTLNLNTKQEETSV
>gi|145231560|ref|XP_001399257.1|	   348 residues, 50 /line  hypothetical protein An02g01180 [Aspergillus niger]
MLSTQ-------------------------------------------------------
--------------------------------------PRRTS--KRVIASY----LLDW
------------------------------------------------------------
-----------------------------------AFIIIL-------------------
----VVTG---------GILYKITGSEHVF------SLDDA------NI-SYPLKS----
------------------------------------------------------------
------------------------------------------------------------
----------------------DTVSITTVGIVCCVVPALLIAAICLL---TPLP-----
-------------------------------------------------------WHRRL
WEWHAG-----------WLGLALSLAGAFFLTSGLKDVVGKPRPDLLARCQPDLTNLTTY
AVGGLGLQRAESPVM-VTSAICQ-NP----DATVIKAGFAAFPS----------------
----------GHSSFSWAGLLYLSLWMGAKFAVSVPVRSTALSAAGRDKKTDSSFSRASA
I-AAPPLYLLVL-IAIPVGGALYICASRYMDYMHAGWDILGGSLIGIVFAILGFMWYHAP
A--GLA-----YGGWAWGS----------------------------------------R
QSDGAFGAGFGDGLCAGSGSR-NKEGSRD------------------------------G
YQDLELGAMHASQ----------------------------------------GVIRDA
>gi|145257482|ref|XP_001401753.1|	   298 residues, 50 /line  hypothetical protein An04g03870 [Aspergillus niger]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------MLVESPGLTSLIGVSLAQEVRTRY--------PDCR-----
---------TPLSVL-ANMHLSK-TA----SDHGLQVGQR--------------------
------------FKTSFAGLFYLTLWLSGKLHIMDN------------------------
---RGEAWKTLL-VMIPSLAATLVAVSRIMDARHHPFDVITGSLLGIICACISYRQYFPS
L--NEP----WKKGRA---YPIRTWGRDPVGPVETVRLVGTDGSTAALRNPEEERLNEAP
QSKTTGSDAGRPLYLPESNPY-TTNMYGY-SRRDEDDNWSSSSEDVAGGYEMQPGYARTQ
NPALNGPTARLDVDTAYHSQTPQVVLGAATTHETPGAIPTHADRGRDLTDMPYRE---V
>gi|146415899|ref|XP_001483919.1|	   243 residues, 50 /line  hypothetical protein PGUG_03300 [Pichia guilliermondii ATCC 6260]
------------------------------------------------------------
------------------------------------------------MSKF----NAEW
------------------------------------------------------------
-----------------------------------LVVVGL-------------------
----LLYF--------YLVAEPSKPFVRPF------RLSDP------SI-QFPFATHER-
------------------------------------------------------------
------------------------------------------------------------
------------------------VTDNQLYVISCILPSLAITAWCTA--LLKRK-----
----------------------------------------------------KLTKFQFQ
QLVNTS-----------LQNLWLSISITGVITDVLKAWIARHRPDFLERCGPIVG-----
---------TPIDKL-VGIEVCS-APL---GQIYLVDGMKSTPS----------------
----------GHSLIAFAGLFYFSLWIYSRIGHLS-------------------------
------IGYQLS-SCLPSLLATYIALSRTQDYRHHYSDIIIGSAMGIAIATITFFRKEK-
----------DKTELP--------------------------------------------
------------------------------------------------------------
----------------------------------------------------------L
>gi|146420035|ref|XP_001485976.1|	   348 residues, 50 /line  hypothetical protein PGUG_01647 [Pichia guilliermondii ATCC 6260]
MISLQGLYA---------------------------------------------------
-----------------------------------DRPLGKLPISLYTATSC----GLDW
------------------------------------------------------------
-----------------------------------FLYLFF-------------------
----ATIS--------ITLGVLTLP-SHEY------AVQDL------RL-QYSYTPNET-
------------------------------------------------------------
------------------------------------------------------------
------------------------FPIWQLVFITIVCPPILFFAISCL---DFRR-----
-----------------------------------------------------VTIFRIL
WDTFAG-----------LTALCGSMATQILIVCVLKNTLGLPRPDFLDRCQPSIE-----
---------FGM----GTIADCT-ST----DDGILREGFRTFPS----------------
----------GHSSTAFTAMTMVSLFSAGKLQVFDN------------------------
---RGVSIKIAL-VVAPMILASTIASSRIADNRHFLSDTLAGAAIGIFCAYWFYRQYFPS
V--LLL-----TNKGRA--YPPRRNG--------VSHLFGNVGGFWFI-----------E
ESDNGQYCKRCLNRP----ST-CKKLVQL-GIVDHD----------THAV----------
-----SVGSSLEAASKAKAQLG------------------------HTVNLDT----PL
>gi|146453151|gb|EDK47407.1|	   304 residues, 50 /line  hypothetical protein LELG_05588 [Lodderomyces elongisporus NRRL YB-4239]
-------MSMEGLLN--NLPSPQFN-----------------------------------
-----------------------------------RANLGFIPRR--IVKWR----VTDL
------------------------------------------------------------
-----------------------------------ALLAVL-------------------
----VIS---------YFFIYRIKPFHRQF------YINDI------TL-QHPFAERET-
------------------------------------------------------------
------------------------------------------------------------
------------------------VNNLELFIYSTWVPLVIALITSLI---LTK------
-------------------------------------------------------PKYKV
YNTYVA-----------CLGLLLAVLVTSNVTDILKNLIGRHRPDFLSRCKPDPS-----
---------TPKDVL-VSIEVCT-SK----DTGLLEDGYRTTPS----------------
----------GHSSIGFAGLVYLALFLMGQFQANST------------------------
---RVGSWRTLLCGFTPLLVASFIALSRTEDYRHHFVDVFIGSMLGLVIGSWSYLRLFPW
I--SNP-----QSYSNLIM-----------------------------------------
------------------------------IAEEEE----------DAENRHKV------
--GDVVIDGEAD-----------------------------------------TMLEDV
>gi|19112260|ref|NP_595468.1|	   279 residues, 50 /line  phosphatidic acid phosphatase [Schizosaccharomyces pombe 972h-]
---------MEAVG--------------------KH------------------------
---------------------------------------------VKLFWNV----YSDY
------------------------------------------------------------
-----------------------------------AVLIAI-------------------
----SLSY--------FVFDVLMLPFTRQF------SLEDI------TI-SHPFALHEQ-
------------------------------------------------------------
------------------------------------------------------------
------------------------VPTKYLGIICVFFPALVLYGFGKL------------
--------------------------------------------------------RNNS
LLFWKS-----------LMGLLYSTMVCGLCVSLLKNAVGRPRPDFLARCQPFES-----
---------TPKTGL-VDVLSCS-VP---WSDKVLQDGFRSFPS----------------
----------GHTSFSFAGLGFLAIFLAGQLKMFRN------------------------
---KTSSWKVVV-PLVPLSIASWIGLSRSQDYRHHKEDIAVGALFGFAIAYVVYRQLFPP
L--DHH-----NADILYVQAEL--------------------------------------
---------------------------------DEG----------YTNVHSAGNS----
-------------------------------------------------SATNAEQM-V
>gi|24652084|ref|NP_724787.1|	   379 residues, 50 /line  wunen CG8804-PB, isoform B [Drosophila melanogaster]
MPAVKIIMSTETSA--------------------SETTPLRRSENETPDHKELAQSNSNS
RQTTVNSNNNNYSNSVQVRLQEQDRDSDSEQQQHTATITMDTN--KRILCRV----GLDV
------------------------------------------------------------
-----------------------------------LILLCA-------------------
----GFPI--------LLFFLLGEPYKRGF------FCDDE------SL-KHPFHD----
------------------------------------------------------------
------------------------------------------------------------
----------------------STVRNWMLYFIGAVIPVGVIFIVEVI---ISQN-----
KAKQDNGNA-----------------------TSRRYVF------------MNYELPDWM
IECYKK-----------IGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGS--
----TCDDAINAGK-YIQEFTCK-GVG--SSARMLKEMRLSFPS----------------
----------GHSSFTFFAMVYLALYLQARMTWR--------------------------
---GSKLLRHLL-QFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVAN-YVSD
L--FQK-----PNTKPYLARTV--------------------------------------
--------------------------------------------------QDMNASPAQA
ITITT-----------------------------------------------------N
>gi|24668567|ref|NP_649391.1|	   334 residues, 50 /line  CG11440-PA [Drosophila melanogaster]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------MHTFKRGF------FCSDL------SI-RYPYKD----
------------------------------------------------------------
------------------------------------------------------------
----------------------CTITVPMLLLMMLLLPMLFVAVVEIM---RICK-----
----------------------------------------------------RFRTRLYF
RNLWRA-----------EATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDDGS--
----SCSDLQNAEL-YVEQFHCT-NNNL--STRQIRELHVSFPS----------------
----------AHSSLSFYSMVLLALYVHGVWRGRG-------------------------
---GVRVLRHVL-QFLLLMAALCVSLSRVADYWHHWSDVLAGALLGVTYAAITAAYVGNL
L--RRQ-----TSSTGRI-PPSLNYS--------HHLHHQ-----LMA-----------D
NNNSTASAKVHFLAAAASASM-TTTTPLD-DIQDSD----------VEDSRDCRDSEDSH
DSQDSHAENEDDNEEVYKSQMS------------------------RPVTPPTDLTHVV
>gi|24668581|ref|NP_649395.1|	   305 residues, 50 /line  CG11425-PA [Drosophila melanogaster]
------------------------------------------------------------
------------------------------------MSFNLS---LRPPIRL----LVDL
------------------------------------------------------------
-----------------------------------VLLGLL-------------------
----IVLVE-------NFRRLWGPPTKRGF------FCDDE------SL-MYPYHEN---
------------------------------------------------------------
------------------------------------------------------------
-----------------------TVSPTLLHWLGLYLPLISLVVLESF---LSHR-----
---------------------------------------------------KDMAPWPTL
WPVYNT-----------VRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSC
----LDESHRGALK-YHTDYECR-PNLSQATEEMIRDVNVSFPS----------------
----------GHSAMAFYGLVFVALHLRRRR--WPL------------------------
---RGSLLSPVL-QLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSALAVTRAAASE
E--LQW-----RCQDSLAS-----------------------------------------
------------------------------AKQEAA----------VVDVADV-------
-----------KGGQQ----MP------------------------HDLSLVTCHIS-N
>gi|28571517|ref|NP_730949.2|	   363 residues, 50 /line  CG12746-PB, isoform B [Drosophila melanogaster]
-------MTASKEG-----------------------QESRRTLSD-SSAEDVRNTGSRT
RT--------NDDEMWRNELAMNTDSSSVQPEKREERSHRTGN--SNAKLSD----AVDV
------------------------------------------------------------
-----------------------------------VLRVLL-------------------
----VITF---------FKLETMTAFKREI------HEEEL------WL-YKNPRRPD--
------------------------------------------------------------
------------------------------------------------------------
-----------------------IVRGGELLFWVIVAPFLVTIAFYWY------------
--------------------------------------------------------TRDR
RDFRAA-----------SWAWTLALCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVL--
-----NTTSNGVDT-SILDFNCT-GL-----PGDINEGRKSFPS----------------
----------GHSSFAFASFGFIAYYIGAKLHAFDS---------------------RG-
---RGHTWRLCI-AVIPLFIALLVAVSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYPS
I--FCP-----DAGIPLVRWPSRE------------------------------------
---GSQYQRLSG-------------------KDDNG----------SRGPHHLDGGDAVR
RPLLA---------------------------------------------DKEESKW-Y
>gi|33589398|gb|AAQ22466.1|	   340 residues, 50 /line  RE35738p [Drosophila melanogaster]
-------MRDAPED-----------------------QSVT--VSM-PASA---------
-----------------SGSAAGST--GPSSDRR-------------MTQRL----LVEL
------------------------------------------------------------
-----------------------------------LVVVVL-------------------
----VIPI--------CVYEFAVDPVRRGF------FCDDE------SI-SYPFQDN---
------------------------------------------------------------
------------------------------------------------------------
-----------------------TITPVMLGLIVGLLPALVMVVVEYV---SHLR-----
AGDISATVDLL-----------------------------------------GWRVSTWY
VELGRQ-----------STHFCFGLLLTFDATEVGKYTIGRLRPHFLAVCQPQIADGS--
----MCSDPVNLHR-YMENYDCA-GEGF--TVEDVRQARLSFPS----------------
----------GHSSLAFYAMIYVALYLQRKITWR--------------------------
---GSKLSRHFV-QFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALITAHYIARM
F--DDG----A-SNILSGGL----------------------------------------
------------RRENTAATL-------Q-EEVCPT--------------------TPPP
YSVNNSFSEDQ------------------------------------------YCSK-V
>gi|45184740|ref|NP_982458.1|	   338 residues, 50 /line  AAL084Wp [Ashbya gossypii ATCC 10895]
---------MHSEG-----------------------IYFR--LGT-KDHDQSLEGYAAP
KL--------PYTLHGESKMAVDRV--TL------SIPKFKKQDL--LEKWR----FTDV
------------------------------------------------------------
-----------------------------------LFCIAL-------------------
----VGA---------NVGVYFAKPFERQF------TINDI------TL-SHPFAQVQR-
------------------------------------------------------------
------------------------------------------------------------
------------------------VNDAMLVVYSFVVPLAVIIVVSLL---FAD------
-------------------------------------------------------PSHRY
YLLYIS-----------VLGLFLSFLSDMIITNYIKNWIGRCRPDFLERCMPREG-----
---------LEKDVL-YGIEVCT-TT----DTDRLLEGFRTTPS----------------
----------GHSSESFAGLGYLFLWLSGQLLTESP------------------------
---AVGAWRKAV-AFIPLMAAAVIALSRTQDYRHHFVDVILGSILGMWIAWWSYRRNFPA
I--QSY-----VPFKPLLDNSDVGL-----------------------------------
---------------LNAPML-------P-----------------RSVDEEMAPLNTPS
VQ-----------------------------------------------SRSGTAQ--V
>gi|46110274|ref|XP_382195.1|	   369 residues, 50 /line  hypothetical protein FG02019.1 [Gibberella zeae PH-1]
-------MPLLPRI-----------------------NPDA--AAT-----PQSK-----
-----------------------------------RATLKAFLRK--WLKVN----YQDL
------------------------------------------------------------
-----------------------------------LCMAFV-------------------
----GALAYGI----YHSPVIITRTFPITF------DATSGDI-VYPQW-AYPDRG----
------------------------------------------------------------
------------------------------------------------------------
----------------------WIIPAWLSGLISIAIPIITYIVAQI-------------
-------------------------------------------------------QIKSV
WDASNA-----------IIGTVWSVTLASLFQVTLKQLVGGFRPYFLDVCMPDISLAKTH
NKTGLNGVG-FYQIM-YTTEICT-QP----DQSRIQNAITSFPS----------------
----------GHTTAAFAGFGFLFLWLNAKLKVWAD---------------------H--
---KPAFWKLSL-TFVPVLAAVLIAGSLTIDAAHNWYDILGGGFIGTIMAFASYRSTYAS
V--WDW----RFNHLPLQETESFRYG--------FDGDLD--------------------
--YAAQTLSLAAGWGGKKVRL-------P-ESSSGP----------AISTESTLRSGAEE
IENLDANTR-------------------------------------RKRRGPVGEEA-V
>gi|46121977|ref|XP_385542.1|	   292 residues, 50 /line  hypothetical protein FG05366.1 [Gibberella zeae PH-1]
------------------------------------------------------------
-------------------------------------MRQMETHS--LQTTH----APDY
------------------------------------------------------------
-----------------------------------VGFLFL-------------------
----LAGW--------ILTVLFVDPFHRMF------FINDL------QI-SYPYAVHER-
------------------------------------------------------------
------------------------------------------------------------
------------------------VPVFMNFVYALFIPLGVLIAFNVA------------
-------------------------------------------------------TRAPA
AKHEVT-----------YLSFLISIVLTSFITDIIKNAVGRPRPDLLDRCQPAVG-----
---------TKANTL-VTIDVCT-RE----DGHILQEGWRSFPS----------------
----------GHSSFSFAGLGFLSLFLAGQLHVFRY---------------------AA-
--GGRDLSRALV-CLLPLIGAGMVAISRCEDYRHDVYDVCVGSALGMSIAYWSYRRHWPR
L--SSQ-----KCDEPYPRPGV-----------------D--------------------
--TQPGWQRFTD------------------DEE---------------------AARGTD
VGFEM---------------------------------------------DNLRGSR-R
>gi|50424917|ref|XP_461050.1|	   309 residues, 50 /line  hypothetical protein DEHA0F17182g [Debaryomyces hansenii CBS767]
-------MDNVKKK-----------------------VYSA--LNY-----FHTDDDFNR
VT--------F------------------------GLKRNALSAR--LVRWR----FADL
------------------------------------------------------------
-----------------------------------VLLGVL-------------------
----CVL---------YIVTYKIEPFQRQF------FINDL------TI-SHPFAESER-
------------------------------------------------------------
------------------------------------------------------------
------------------------VTNGALFFYSVWEPIMVIGVIGLI---MTK------
-------------------------------------------------------PENKI
YVTYVS-----------ILGLCISCFTTSVVTDVLKNLIGRHRPDFLARCVPRSD-----
---------APLNVMVFAKDVCT-TD----NLDLLKDGFRTTPS----------------
----------GHSSISFSGLVYLSLWLSGQLVIMNE------------------------
---NLGYWRSIL-AWIPTLQCTYIALSRTEDYRHHFVDVIIGSLIGLGMACWAYRRLFPH
I--THP-----KSYEPYII-----------------------------------------
------------------------------ISEEED----------NDNPDTQY------
----NRINQDE-------------------------------------------SLS-V
>gi|50546837|ref|XP_500888.1|	   278 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
------------------------------------------------------------
--------------------------------------MLSSSST--LKQYH----VIEW
------------------------------------------------------------
-----------------------------------ITAFTL-------------------
----IFL---------WYVSESAAPFTREF------IISDP------TI-NHSHVTVER-
------------------------------------------------------------
------------------------------------------------------------
------------------------VSSEACILYTIIIPFFVLIGLSAI---MAPR-----
-------------------------------------------------------PQDRL
KFMSIT-----------LSTFLVAAFFNGFITNFLKIYMGRHRPDFIARCEPSKR-----
---------APIDKY-VTIEVCT-GD-----MDTILEGMKSTPS----------------
----------GHSSTAFVGMTFFCLWVYGQINAYKT---------------------Y--
---GSKASKLLL-AFFPLLLAIYIALSRTEDYRHHFVDIVLGSLLGMTIAYYFYRREFPR
T--TSK-----TSHIPYCL-----------------------------------------
------------------------------GSEGAD----------DDHHY----DRVDD
VQLEN---------------------------------------------------Q-V
>gi|54696046|gb|AAV38395.1|	   312 residues, 50 /line  phosphatidic acid phosphatase type 2B [synthetic construct]
-------MQNY--------------------------------------------KYDNA
IV--------PESKNGGSPALNNNP--RRSGSKRV--------------LLI----CLDL
------------------------------------------------------------
-----------------------------------FCLFMA-------------------
----GLPFL-------IIETSTIKPYHRGF------YCNDE------SI-KYPLKTGET-
------------------------------------------------------------
------------------------------------------------------------
------------------------INDAVLCAVGIVIAILAIITGEFYRIYYLKK-----
--------------------------------------------------SRSTIQNPYV
AALYKQ-----------VGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCS
E-------------GYIQNYRCR-GD-----DSKVQEARKSFFS----------------
----------GHASFSMYTMLYLVLYLQARFTWR--------------------------
---GARLLRPLL-QFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVF-FVSD
L--FKT-----KTTLSLPAPAI--------------------------------------
---------------------------------------------------RKEILSPVD
IIDRN----------------------------------------------NHHNMM-L
>gi|56758956|gb|AAW27618.1|	   281 residues, 50 /line  SJCHGC05833 protein [Schistosoma japonicum]
-------MKPF-------------------------------------------------
---------------------------------------------VYGIIRV----ISDL
------------------------------------------------------------
-----------------------------------AFIAAL-------------------
----IIT---------NTILQNIEPYKRGY------FPQDE------SI-KKPYKS----
------------------------------------------------------------
------------------------------------------------------------
----------------------NTISSTILYIVSSLLILFTIVLGEV---IVGSK-----
--------------------------SLRRTH---------------------HRIPVIL
YPIYDS-----------LIVAFFGYFATIGLTDVGKVAFGRLRPNFIDACKPSGYTT---
-----------TNLGFISNITCS-AD-------KSTGLRKSFPS----------------
----------GHTSIAIYSATFLCLYIQLRFSRYRI------------------------
----YPSIRTCF-QMTYIALGLVVGYSRILDNKHHWSDVLGGGLLGFLLALSTLY-YLPY
C--GDT-----TDSLPTCK-----------------------------------------
--------------------------------DDQI----------IVEFD---------
---------------R----PE------------------------SSAFSPADKSS-Q
>gi|58259405|ref|XP_567115.1|	   354 residues, 50 /line  phospholipid metabolism-related protein [Cryptococcus neoformans var. neoformans JEC21]
-------MSSVADA-----------------------VRFC--FPT-----APIGPEAAI
DF--------PLYARNESQLAQGKV--RHEEEERVVSPVQATF--KTICASY----APDW
------------------------------------------------------------
-----------------------------------IIVFVL-------------------
----WAV---------LVILDRSGGHKREF------SLNDV------SI-QHSFAEHER-
------------------------------------------------------------
------------------------------------------------------------
------------------------VPPVLLVLFSIVVPLLVLVPLSSL------------
-------------------------------------------------------IARNA
WDTHNS-----------VLGLLMSYTMTGVVTQIIKMSVGRPRPDLIARCMPIEGAMDH-
----------PVFGL-TNVSICT-NT----DAFILDDGFKSFPS----------------
----------GHSSMSFAGLGFLSLYLAGKMHLWDN------------------------
---GGHRTRAWA-ALSPLLGATMVAISRTEDNRHHWQDVLIGSILGLFIAWVAYRTYYPP
L--SHN-----QCHLPLAPRTD--------------------------------------
---PDNYQDFPL------------------DDEEQG----------RGGPRDRVRLLSEE
TDGRA-----------------------------------------GEEQVAWQATG-R
>gi|6320711|ref|NP_010791.1|	   274 residues, 50 /line  Lipid phosphate phosphatase, catalyzes Mg(2+)-independent dephosphorylation of phosphatidic acid (PA), lysophosphatidic acid, and diacylglycerol pyrophosphate; involved in control of the cellular levels of phosphatidylinositol and PA [Saccharomyces cerevisiae]
--------------------------------------------------------MISV
MA--------DEKH-------------------------------KEYFKLY----YFQY
------------------------------------------------------------
-----------------------------------MIIGLC-------------------
----TILFL------YSEISLVPRGQNIEF------SLDDP------SI-SKRYVPNEL-
------------------------------------------------------------
------------------------------------------------------------
------------------------VGPLECLILSVGLSNMVVFWTCMFD-----------
-------------------KDLLKKNRVKRLR------------------ERPDGISNDF
HFMHTS-----------ILCLMLIISINAALTGALKLIIGNLRPDFVDRCIPDLQKM---
---------SDSDSLVFGLDICK-QT----NKWILYEGLKSTPS----------------
----------GHSSFIVSTMGFTYLW----QRVFTT---------------------RN-
--TRSCIW-------CPL-LALVVMVSRVIDHRHHWYDVVSGAVLAFLVIYCCWKWTFTN
L--AKR-----D------------------------------------------------
------------------------------------------------------------
---------------I----LP------------------------SPV-------S-V
>gi|66809727|ref|XP_638587.1|	   271 residues, 50 /line  phosphoesterase, PA-phosphatase related-family protein [Dictyostelium discoideum AX4]
-------MIHR-------------------------------------------------
------------------------------------VSFYGKTTW--FTKQH----LIDW
------------------------------------------------------------
-----------------------------------FLCLGI-------------------
----FVIES-------VLFNFVIPPFKRYE------PESNISTNTFQLV-QYPLLP----
------------------------------------------------------------
------------------------------------------------------------
----------------------DIVPVWLLMLIALGLPMVVFIGYYI-------------
-------------------------------------------------------KNRNS
HDFHHA-----------ALGLFQAFTITMLFTDILKVSAGRYRPDYGARVAT--------
------------------------GI-----EAVIREGRVSFPS----------------
----------GHSSVSFCGMTFLSFYLCGKTKVFLK---------------------D--
---GGNILKALV-CLCPFMISALVAVSRTVDYHHDFSDILAGSVIGLSIGVFVYFMNFNS
L--FSK-----ECSLPKNR-----------------------------------------
-----------I------------------NPHYAR----------DG------------
-----LLSAEYQ-------------------------------------SLSISSS--L
>gi|66824401|ref|XP_645555.1|	   366 residues, 50 /line  phosphoesterase, PA-phosphatase related-family protein [Dictyostelium discoideum AX4]
-------MENSGLL--------------------------F--NND-----ETIINKKIK
KI--------IYENQYDKP-----L----------FYDIDLRK--NNKKLIY----LLDW
------------------------------------------------------------
-----------------------------------FCVVVL-------------------
----LVI-G-------SILLLKVPVRGRLF------RLNDE------SI-SYPKLE----
------------------------------------------------------------
------------------------------------------------------------
----------------------EIIPLGLLIPLVTAVPFAMILLISII------------
-------------------------------------------------------FKRDI
NDFHHS-----------LLGFLQSISVTILLTGSFKVFIGGLRPSFLEFCKPTKESIVAG
----NPPVG-YGAIY-YDRSICT-ES-----EFIVNDGLSAYPS----------------
----------GHSSIAASCFGFLALYLLARLKCFDN------------------------
---RGHIIIYLL-IIGCLITAGLIGISRVADYRHTFLNVLAGWSIGLLISLSCYRLNFSS
L--FGR-----DNHISIHSHWLTYWD--------YHNNNN--------------------
--NSNSNNNNNN------------------NNNNN-----------NNNNNNNNNNNNKK
DNINNNSTKTQNNFES----YQ------------------------SPNGIPLNELQ-N
>gi|67467281|ref|XP_649759.1|	   255 residues, 50 /line  lipid phosphatase [Entamoeba histolytica HM-1:IMSS]
-------MSIWTKI----------------------------------------------
-----------------------------------KHSFS-----LLDISEI----FSDV
------------------------------------------------------------
-----------------------------------IVFGI--------------------
----SLL-T-------IVITLFCSPNQMVI------PNEKNNV----NV-DYLYVEKE--
------------------------------------------------------------
------------------------------------------------------------
-----------------------TIPFWLCALISYVPPLLLILLFSL-------------
-------------------------------------------------------FKKSS
KFLFYS-----------LFCLILCISSNIAITNCAKLFAGRPRPHFYARLSEH-------
-------------------------------PEQVKSVYQSFPS----------------
----------GHSSSISNGMTFCTLFLAGQMKIFAS------------------------
---SQESWKLLV-VSLPSIVAIFIMITRTRDYYHNFSDIIGGGIIGLFTAFIFYCNKFNS
L--SSD-----HSDDL--------------------------------------------
------------------------------------------------KITSISQLEDQ-
----------------------------------------------------TDIFD-V
>gi|161968|gb|AAA30153.1|	   372 residues, 50 /line  fructose-bisphosphate aldolase (ald) (EC 4.1.2.13)
-------MSKRVEV--------------------------L--LTQ-----LPAYNRLKT
PY--------EAELIETAKKMTAPG----------KGLLAADESTGSCSKRFAGIGLSNT
------------------------------------------------------------
-----------------------------------AEHRRQ-------------------
----YRA-L-------MLECEGFEQYISGV------ILHDE------TV-YQKAKTGET-
------------------------------------------------------------
------------------------------------------------------------
------------------------FPQYLRRRGVVPGIKTDCGL-------------EPL
VEGAKGEQMTAGLDGYIKRA---------------------------KKYYAMGCRFCKW
RNVYKI-----------QNGTVSEAVVRFNAETLARYAILSQLCGLVPIVEPEVMIDGTH
D-----IETCQRVSQ-HVWSEVVSALH---RHGVVWEGCLLKPNMVVPGAESGLKATAEQ
VAEYTVKTLARVIPPALPGVTFLSGGLSEVM-------------ASEYLNAMNNCPLPR-
--PWKL----------------------TFSYARALQSSAIKRWGGKESGVEAGRRAFMH
R--AKM-----NSLA---------------------------------------------
-----------------------------------------------------------Q
LGKYNRADDDKDSQ-----------------------------------SLYVAGNT-Y
>gi|67469998|ref|XP_650970.1|	   245 residues, 50 /line  phosphatidic acid phosphatase [Entamoeba histolytica HM-1:IMSS]
------------------------------------------------------------
-----------------------------------MLNFRSIKQQ--CTKTL----VIEF
------------------------------------------------------------
-----------------------------------SIGVIL-------------------
----FVG-G-------I-LLKYLPSYQMDI------PLERKNF----NV-TYPLVS----
------------------------------------------------------------
------------------------------------------------------------
----------------------ETFPFLFCCIFSWCIPVIVIFYFAQ-------------
-------------------------------------------------------KRNSS
KYFITS-----------ITSFFFAVSLCLFLTNAFKLFAGKPRPNYYSLIDN--------
--------------------------------KKASKVYQSFPS----------------
----------GHSSTTFNGMMFLTLLLCGEYKIFNG------------------------
---EGSILKLVG-CCLPLLFGCIVAISRVRDYFHGYDDIIAGSLLGCLTAVLCYVLKFKV
L--WST-----NSGE---------------------------------------------
-----------------------------------------------IETEEYKEFDD--
------------------------------------------------------NYI-V
>gi|67473662|ref|XP_652582.1|	   259 residues, 50 /line  lipid phosphatase [Entamoeba histolytica HM-1:IMSS]
------------------------------------------------------------
MD--------ILQQLY----------------------LPLLH--KSVLLNV----IYDI
------------------------------------------------------------
-----------------------------------VVIVIF-------------------
----VII-S-------I-VCVFVTPHHMDI------PKDRENV----NV-LYPLYS----
------------------------------------------------------------
------------------------------------------------------------
----------------------SSVPTWACIIIGYIPPVLTILLITI-------------
-------------------------------------------------------KKKSS
LFLLFS-----------LLSLGLSASMCLGVTNMGKIFAGRPRPHFYARIDAK-------
-------------------------------PNEINDAYMSFPS----------------
----------GHSSAIFNGMTFLALLIAGQIHAFSI---------------------A--
---SHESWRMLI-VLLPFIIAGTVAISRTRDYHHNFSDIIAGSLIGIFFALLSYCSKFKR
L--SDE-----HSDDL--------------------------------------------
------------------------------------------------KIEDVVKSQE-P
FPLED-------------------------------------------------EEK-Q
>gi|67478931|ref|XP_654847.1|	   243 residues, 50 /line  lipid phosphatase [Entamoeba histolytica HM-1:IMSS]
------------------------------------------------------------
-------------------------------------MWKEQWIT--FLKKR----KIDI
------------------------------------------------------------
-----------------------------------IITFIV-------------------
----FVL-S-------KLF-GLLPPFKMET------PHNHP------SY-HYSKHE----
------------------------------------------------------------
------------------------------------------------------------
----------------------NTFTRNMTITIDFFIPLICIILLCL-------------
-------------------------------------------------------KNHYI
SGLFNS-----------ILSFIFNDSLNGTITQLYKIFAGRPRPFYFNGCNPSL------
-------------------YTCT----------------KSFPS----------------
----------GHSSFSMAGLLFLSLFLYFYFKKSNI---------------------H--
---LNSLSSVFF-CGLPSFLAIIIAVTRTRDHYHHFSDILGGSILGGFVAIISFFSTFQR
F--YTE-----EEDET--------------------------------------------
-----------------------------------------------VDYE---IINNKT
VLLEE-----------------------------------------------------E
>gi|68484435|ref|XP_713828.1|	   261 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Candida albicans SC5314]
------------------------------------------------------------
-M--------LQIYFT-----------------------------SSKFRKF----IPDW
------------------------------------------------------------
-----------------------------------IVVILL-------------------
----VII-F-------FQVTEVAQPFARQF------YINDP------TI-SHPFATQEQ-
------------------------------------------------------------
------------------------------------------------------------
------------------------VTDNQLYLYSVLIPSLIISLISL---YLGES-----
-------------------------------------------------------NFEKL
HNLQVS-----------CLGLWLSVCVTSVLTDVLKCWISNPRPDFLERCGPQKG-----
---------TPENKL-VGIEVCT-SPL---GPMYLSDGLKSTPS----------------
----------GHSSMAFSGLLYLSLWLVGQFKLIQK---------------------R--
----KSIGYVLI-AGLPILVAAYIALSRTQDYRHHFFDIGFGSAIGIVFAVIFYYKYFNS
L--SDE-----SCNVP--------------------------------------------
-----------------------------------------------IDYK---------
----------------------------------------------------------D
>gi|68486075|ref|XP_713054.1|	   284 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Candida albicans SC5314]
---------MTFL---------------------------------------------NP
SS--------IVKYTQ-----------------------------SNQFHDF----IPDW
------------------------------------------------------------
-----------------------------------IVATVT-------------------
----VLF-F-------FSVAETALPFQRQF------SLDDL------TI-SHPFAIKER-
------------------------------------------------------------
------------------------------------------------------------
------------------------VSGILCIEIAAFVPLFVILTSLLVKYQ---------
QGAFSS-------------------------------------------------HQQAL
HCLQIS-----------VLGLIISLSLNGVITDILKIWIARPRPDFLERCGPAPG-----
---------TPLHEL-VDVNVCT-APL---GKALLIDGMKSTPS----------------
----------GHSSISFGGLFYLTLWLLGQFKLFQN---------------------RE-
--SPQYVYKYFL-AFSPLSLATYIALSRTQDYRHHFTDIVLGGAIGISFAWWSYHHYFNK
L--VSE-----ESHKP--------------------------------------------
-----------------------------------------------IDSETLTESLLP-
----------------------------------------------------------H
>gi|68487344|ref|XP_712443.1|	   362 residues, 50 /line  diacylglycerol pyrophosphate phosphatase [Candida albicans SC5314]
-------MKREIFF--------------------------S--FKW-----PFFLGLCSL
SC--------LCRCKKNTQIMVTDW----------VFTINRLQFSGLTTISY----IFDF
------------------------------------------------------------
-----------------------------------LFYLTI-------------------
----LIL-S-------ATLGRTLPPRYHEF------SLYDI------TL-RYTHFPEAT-
------------------------------------------------------------
------------------------------------------------------------
----------------------ILVRVWLLVLISAGIPLTQFLLFSI---FVVLP-----
-------------------------------------------------------IRRRI
WDFLAG-----------CLCLLGAMATQLLVTVLLKNIIGLPRPDFIDRCEPMIQNIPLT
S-------------L-STVAICT-QP----DWNLVQEGFRTFPS----------------
----------GHSATVFTGMTIAALNFAARLQTFDN------------------------
---RNNSFKVFI-TISPWLIAACVASTRVSDNRHFLKDIIAGAFIGTCIGSVFYLQYHPS
I--FNL-----ANAGRS--FPPRRFG--------IQRFFQ--------------------
--NIGGFWKLDG------------------ESSD-R----------ALGAEDLEKLSNEQ
LGQPARITSMAD-------------------------------------NIEVVNKL-L
>gi|70995150|ref|XP_752340.1|	   353 residues, 50 /line  PAP2 domain protein [Aspergillus fumigatus Af293]
------------------------------------------------------------
------------------------M----------RPALSRIPLR--LVFSY----ILDW
------------------------------------------------------------
-----------------------------------IFIVIV-------------------
----AVI-G-------FGFH-KVQPNHRPF------SLTDP------SI-SFPYTEHET-
------------------------------------------------------------
------------------------------------------------------------
------------------------VSTAVLMVVALIAPAVIIVITAL---LIPMS-----
TKDQNVPRSSL--------------------------------------------WRYKL
WEWNAG-----------WMGLAVACAWAWMATEGLKDLYGRPRPDMLARCNPDLSNIATY
AVGGLGENLAGAPTM-VTWKICQ-NK----SKVLANDGFASFPS----------------
----------GHSSFSFAGLTYLTLWLCSKLSIAFPYLGHSLLNQNPIGPINGSIRKRG-
--AAPPVYMLVV-AFVPIAVASFIGASRWFDYRHHAFDILFGSIMGAIFAWIGFRMYHLP
I--TRG-----EGWSWA--ARSRRH-----------AFFK--------------------
--SP----RFPS------------------EADERR----------PIDTHDTQKTTRQD
IDVER-----------------------------------------------AAENL-V
>gi|71411248|ref|XP_807881.1|	   317 residues, 50 /line  phosphatidic acid phosphatase protein [Trypanosoma cruzi strain CL Brener]
---------MSACV--------------------------R--VVV-----VFFFLCVCV
SF--------SLFFVPFSPLWGVSV----------GMDINRLVLY--WKNYQ----LLDF
------------------------------------------------------------
-----------------------------------VLGLFL-------------------
----LIF-S-------SILVFVVPPYCRPF------SWNDP------TI-NYPYVTNVA-
------------------------------------------------------------
------------------------------------------------------------
------------------------FPAWSLLLMFVLALIFYVA--VLTSLGGP-------
------------------------------------------------------------
--IWVW-----------LKAQTLAVISQLVVVNLLKIYAGRIRPDYLERLRSLGIDENTY
AKIDV------KYMS-STEFYCKLGV----EHRVLREGRLSFPS----------------
----------GHSSTSFSVLAFMSLFLFAHTQPSSR------------------------
---GGSFLRLIL-SLSPLAIAFLCAVSRTRDYWHHFDDIVAGALIGTVSALMCFYNAFYI
T--EDG-----RCVARV-------------------------------------------
---------IEL------------------AQQEER----------AGEISNGRP-----
----------------------------------------------------LSVVV-A
>gi|71660303|ref|XP_821869.1|	   315 residues, 50 /line  phosphatidic acid phosphatase [Trypanosoma cruzi strain CL Brener]
------------------------------------------------------------
-----------------------------------MLPYQKVLKV--LQKLR----IVDY
------------------------------------------------------------
-----------------------------------LLCVFL-------------------
----CTA-A-------LTIGKKVRPHCRQF------SWQDA------TI-GHTYAGAGL-
------------------------------------------------------------
------------------------------------------------------------
------------------------FPSWSLAPIAILPALIYFVVELIRALL-----WRPD
TRPSHGPSTSLDLVTNALETRNSERMNMRRCHTEEADGGTVINTSDGEEAGGNARWWLFL
EKLNHW-----------LLAQAFSVTLSMFIVDITKLYAGRLRPDFLARLENEGYSEKST
-GVD----------------WC----------KVAREGRLSFPS----------------
----------GHAAISFSSIVTLVLFFVGHLQVF-Y------------------------
---FASPLRLFL-SMLPLILPIVVAVSRTRDNRHHFSDVLAGGIIGTGCALLSVTVLFRV
V--KRN-----GMFLPR-------------------------------------------
----------RQ------------------DYAS--------------------------
--------------------------------------------------------K-R
>gi|71749074|ref|XP_827876.1|	   332 residues, 50 /line  phosphatidic acid phosphatase [Trypanosoma brucei TREU927]
---------MATGG----------------------------------------------
-----------------------------------RSSFAVYLYY--AKVLR----LLDY
------------------------------------------------------------
-----------------------------------LVAFCF-------------------
----GAT-G-------FLLGRLIRPYCRTF------SWDDL------SI-NNSFAEKET-
------------------------------------------------------------
------------------------------------------------------------
------------------------FPDWSLVVMALVSCLFIFIIEKMRERYSPVGEWYMD
EQLPEPSSNSITSSTNVLSEERAANR--GGASVRERNGLENLPPAPSFERK-VQRKFIVD
QVINLW-----------ILSVVFAFFFSLGIVDVLKIYAGRLRPDFLDRLRREGFNATSP
-PSN----------------AC----------SLAREGRLSFPS----------------
----------GHSSCAFAAFTPLTMYFLGLSRAF-N------------------------
---SGPVWRIIL-SMFPIYLAICVAASRTRDNRHHFSDILGGSVIGLVIGAFSVNIFFRV
R--SGE-----GYLVPR-------------------------------------------
----------RL------------------EPPRRR----------SG-----SP-----
----------------------------------------------------NDNDT-V
>gi|67467677|ref|XP_649928.1|	   250 residues, 50 /line  hypothetical protein 259.t00003 [Entamoeba histolytica HM-1:IMSS]
-------MNKV-------------------------------------------------
---------------------------------------------LNILFQI----GGDI
------------------------------------------------------------
-----------------------------------IYIIVT-------------------
----GAV-A-------AVL-TFIDGFHMEV------PGGENNV----NV-LYPYRD----
------------------------------------------------------------
------------------------------------------------------------
----------------------STFSEAVAGIVIYASTILIIIAFQI-------------
-------------------------------------------------------KRLSF
KHTIFT-----------FIGLGASVTTWLMFVQGGKIYAGRPRPNMYALVA---------
-------------------------------QGKEKDAWKSFPS----------------
----------GHSAASFCGYTYLSLYIAGELRIFSD------------------------
---RPELWRMIP-VIIPMFLAGIIVLTRTRDYYHNFSDVLAGSIIGILSACIGYFSKFES
L--FSP-----KAGEIR-------------------LTCR--------------------
--N--------------------------------------------------HKKNNED
IPDEE------------------------------------------------MAEM-S
>gi|115629247|ref|XP_787511.2|	   258 residues, 50 /line  PREDICTED: similar to Phosphatidic acid phosphatase type 2 domain containing 1A [Strongylocentrotus purpuratus]
------------------------------------------------------------
---------------------------------------------------M----ILEL
------------------------------------------------------------
-----------------------------------LVRIFL-------------------
----LI-A--------FLITEELDPFQRVI------QPEEM------WLYKNPHSVH---
------------------------------------------------------------
------------------------------------------------------------
----------------------STVTTRMLFSSAILVPLCVITIFS--L-----------
-------------------------------------------------------MRKDR
LDFLHAVL--------------------DLDLSLYHCIVKKPRPDFFYRCFPN--G----
--------------VMTTDLKCT-G-----DLDTINEGRKSFPS----------------
----------GHSSFSFCAFGFTAFYLAGKLHTFES---------------------RG-
---RGVGWRILV-TLAPLYVALMVALSRTADYRHHYEDVIAGSLLGLAVAYAIYRQYFPA
L--THA-----TCDKSYARL-----------------------------YALRD------
----------------------------AM------------------SLQEYNTNNAI-
----------------------------------------------STRIPLDSVKT-V
>gi|125809222|ref|XP_692261.2|	   365 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
-------MTLRQTLGDNNAPYTEIWDPYVCKDKRFF------------------------
-----------------------------------GAAPNHSALR---LSEL----NNDS
------------------------------------------------------------
-----------------------------------VVCVSV-------------------
----AMPF--------IIMTIMYRPYHRGV------YCNDE------TI-QYPYR-P---
------------------------------------------------------------
------------------------------------------------------------
----------------------DTISHKMMAAVTISCSVIIIISGEAYL-----------
-------------------------------------------------------VYTKR
LYSNSDFNQYAAALYKVVGTFLFGACVSQSLTDMAKYTIGRLRPNFMSVCAPAVCE----
--------------GYMLEINCT-G-----NARNVTESRLSFYS----------------
----------GHSSFGMYCMLFLALYVQARLASKWA---------------------R--
------LLRPTI-QFFLVAFAIYVGYTRVSDYKHHWSDVVVGLLQGALVAVLTVRYISDF
FKERPP-----RCPDVENAENA---------------------------DVERKPSLQIA
DTDRNNYYPISRPMRLYRLSL-FCTLIYSK------------------CADHLTPNDTV-
--------------------------------------FIVSEHKDELQGELDKLKTTA

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.