Fandom

Proteins Wiki

At2g01110.1/Structure

< At2g01110.1

47,922pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/at2g01110_C1kgpa.pir.txt

======================================================

Assigned types to 340 residues in Sequence 2-01110, 63 remain unknown
Assigned types to 296 residues in Sequence c1kgpa_, 107 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file at2g01110_C1kgpa.pir.txt into sequence alignment.

======================================================

>1KGP.pdb  Made from 9676 ATOM records in 1KGP.pdb
SNEYDEYIANHTDPVKAINWNVIPDEKDLEVWDRLTGNFWLPEKIPVSND
IQSWNKMTPQEQLATMRVFTGLTLLDTIQGTVGAISLLPDAETMHEEAVY
TNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSY
YNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRD
ESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIY
DDLGWTEDVKRFLRYNANKALNNLGYEGLFPTDETKVSPAILSSLSSNEY
DEYIANHTDPVKAINWNVIPDEKDLEVWDRLTGNFWLPEKIPVSNDIQSW
NKMTPQEQLATMRVFTGLTLLDTIQGTVGAISLLPDAETMHEEAVYTNIA
FMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGD
DPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDESVH
GYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLG
WTEDVKRFLRYNANKALNNLGYEGLFPTDETKVSPAILSSLSSNEYDEYI
ANHTDPVKAINWNVIPDEKDLEVWDRLTGNFWLPEKIPVSNDIQSWNKMT
PQEQLATMRVFTGLTLLDTIQGTVGAISLLPDAETMHEEAVYTNIAFMES
VHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLK
KKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDESVHGYYI
GYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLGWTED
VKRFLRYNANKALNNLGYEGLFPTDETKVSPAILSSLSSNEYDEYIANHT
DPVKAINWNVIPDEKDLEVWDRLTGNFWLPEKIPVSNDIQSWNKMTPQEQ
LATMRVFTGLTLLDTIQGTVGAISLLPDAETMHEEAVYTNIAFMESVHAK
SYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVA
STLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDESVHGYYIGYKY
QQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLGWTEDVKRF
LRYNANKALNNLGYEGLFPTDETKVSPAILSSLS

======================================================

Best alignment:
1KGP.pdb    23  IPDEKDLEVWDRL    35
                +PD+K++ ++D L
2-01110    105  LPDDKEMTIFDHL   117

======================================================

Highlighted IDENTICAL residue PRO   25  index1   24  path  123  %Seq 100.00
Highlighted 1 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/at2g01110_C1kgpa.pir.txt.1KGP.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues at2g01110_C1kgpa.pir.txt PIR amino_acid 1KGP.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.