Fandom

Proteins Wiki

At2g01110.1/MSA

< At2g01110.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|18379153|ref|NP_565252.1|	   340 residues, 50 /line  APG2 (ALBINO AND PALE GREEN 2) [Arabidopsis thaliana]
-----------MSSTSTSSALIHHFRLTTRNLGSPTKQRCPYAVTFCNS---WREAGLRY
SVTQRRSKGFGPVSALNDDDSPTETTPGVGSAVEDRPPDSSEDRSSSVYEFLYPRKEELP
DDKEMTIFDHLEELRERIFVSVLAVGAAILGCF--AFSKDLIV-FLEAPVKT--------
--------------------------QGVRFLQLAPGEFFFTTLKVSGYCGLLLGSPVIL
YEIIAFVLPGLTRAERRFLGPIVFGSSLLFYAGLAFSYWVLTPAALNFFVNYAEGV----
---------VESLWSIDQYFEFVLVLMFSTGLSFQVPVIQLLLGQVGVVSGDQMLSIWRY
VVVGAVVAAAVVTPSTDPVTQMLLATPLLGLYLGGAWMVKLTGR----------------
---------------------------------------------------
>gi|103486633|ref|YP_616194.1|	   269 residues, 50 /line  Sec-independent protein translocase TatC [Sphingopyxis alaskensis RB2256]
MSD---------------------------------------------------------
-------------------------------------------------TAPDNPAEEDG
AGGKMPLLDHLIELRSRLLKSLLAIALAFGVCF--YFARPIFA-ILVQPLIAA-------
--------------------------GQGKLIYTQLFEAFFVEVKVAFFASMMIAFPVIA
NQLWKFVAPGLYRQEKRALLPFLFATPALFAVGASFAYFITIPLALRFLLGFQGDV---G
GVT------QEALPSVGNYLDFTMQFIMAFGIAFLLPILLMLIERAGLVSRDQLISARRY
MIVAAFAISAVATPP-DILSQFLLAVPLILLYEFSIFAIWFTQRRRKTGAETA----P--
----------------------------VEP--L--------------EEA
>gi|109672492|ref|ZP_01374729.1|	   257 residues, 50 /line  hypothetical protein Ccon1_01000608 [Campylobacter concisus 13826]
------------------------------------------------------------
------------------------------------------------------------
--MFEELRPHLIELRKRLFISIVSVFVCFGICF--TFWNPLLA-WMSEPLKQVL------
-------------------------PAGSNIIFTQIQEPFFTAMKVAFFAGLVLALPIIF
WQFWLFVAPGLYDNEKKYVIPFVLSASFMFACGAAFCYYVVIPLGFTFLVNFGGQ-----
--L------FTALPSIGEYVGFFTKLLIGFGISFELPVITFFLAKIGLVDDKMLKDYFRY
AVVVIFIFAAIVTPP-DVISQILMALPLIGLYGISIIVAKRAGKSDEDEDEKKEDVKE--
----------------------------QVDADS--------------DDE
>gi|113932910|ref|ZP_01418812.1|	   300 residues, 50 /line  Sec-independent protein translocase TatC [Caulobacter sp. K31]
MTN---------------------------------------------------------
-------------------------------------------------AIGHE-PEDEI
EASRAPLMDHLIELRMRLIICVAALFIGFGVCF--AFADQIFL-FLVNPFTVAQKLLAAQ
HLGGHHGPFDLLLALVGLKDIPATDTKALGLVYTAALEFFFTKLKLAGFGAVVLTFPVLA
WQLYRFVAPGLYKNERYAFLPFLIASPFMFVLGAALVYYIMLPFVLWFSLSQQIST---A
GIS------IQLLPKVSDYLTLVTTLLLAFGLCFQLPVVVSLLGMAGIVSSKLLREGRRY
AIVGVFIAAAILTPP-DPISQMTLAIPMCLLYEISIWCVWLIERRKAKDEREA----S--
----------------------------TDV-----------------ATV
>gi|113938393|ref|ZP_01424261.1|	   250 residues, 50 /line  Sec-independent protein translocase TatC [Herpetosiphon aurantiacus ATCC 23779]
------------------------------------------------------------
-----------------------------------------------------MAKSTTA
IDGTMTLLDHLRELRSRLTKVSIAVLIGMFGGF--YIVNSTGF-IKYVILSFA-------
--------------------------GEQGVQTTQVAETFTTYLSTALTLGIAAAMPVII
YQLLAFLAPGLTRTERKWIFIGLPMVIFCFLGGLAFGWFVTAPAAIKFLINFGIEN---A
GNL------IENKPRLDDFLSILTRLLLINGIVFELPMIMFTLTKLGILNPRKLGRYRRY
VVLITVVAAAILTPTGDPANLAFLAVPMYLLFEFGLLLGRLAQPKPAN------------
---------------------------------------------------
>gi|114331890|ref|YP_748112.1|	   258 residues, 50 /line  Sec-independent protein translocase, TatC subunit [Nitrosomonas eutropha C91]
------------------------------------------------------------
------------------------------------------------------------
MDDDNTFISHLAELRARLIRALLVLFLGFLPCA--FFARELYS-FLAFPLLEKL------
-------------------------PQGGQMIATEVVTPFFIPMKVALMVAFLITLPHTL
YQVWAFVAPGLYSHEKRLFLPLVFISSLLFFTGMAFAYFAVLPLVFEFIVYFAPE-----
--G------VAVMTDISEYLNFILSMFLAFGITFEVPVFVLILIRTGLVSIEKMRSIRRF
VLVGAFIIGAIFTPP-DVMSQILLAIPLYLLYELGILLAALLMKQPTRESVPSA-MQH--
----------------------------QRDNTG--------------KNE
>gi|114566225|ref|YP_753379.1|	   283 residues, 50 /line  sec-independent protein translocase protein TatC [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
------------------------------------------------------------
----------------------------------------------------MALLKDLT
PEEKQTIIEHLEELRKSLIISIIAIIAAAVFCF--YYNEEILS-VIISPLSGL-------
---------------------------GEGLVVIGVTEAFFIKLKLAFYAGFALAFPVVA
WAIWRFFKPALYPEERKYVYVLLPVSVLLFSTGILFSYFGILPLVLKFFIYMQGP-----
--S------LENMFTVERYVSFVTAFTIPFGLVFELPVVVFFLAKFGIIKAETLSKNRKY
ALLAIVVIAAALTPGPDPISQMLMAGPVYFLYEVSIIVAKMAKPRKKTEEEESEEPREPE
PEREEQPRK-PEEEKEG-----------EEQATV--------------DES
>gi|11467559|ref|NP_043705.1|	   263 residues, 50 /line  ORF263 [Odontella sinensis]
-------------------------MFNYPLYIYRQDVKSKLMVTN--------------
---------------------------SDFNF-----------------------TIKET
VTLELPFSEHIEELKQRLFHTFWIILILTFISL--CEVKLLVK-ILELPVNN--------
----------------------------VKFFQLSPGEYFVSTVKISFYTGFLFGSPFAI
GQIILFLLPGLTKKETKIILPLLLSSLGLFGFGLVFSYYALIPAALNFFLNYSDEV----
---------IEPLWSFDQYFEFILVLFYSTGLAFQIPIIQILLGLLNIISAKQMLAAWRY
IILVSTIIGAILTPSTDPLTQLLLSIAILMLYFSGVGILFLIKN----------------
---------------------------------------------------
>gi|114771844|ref|ZP_01449237.1|	   282 residues, 50 /line  twin-arginine translocation protein TatC [alpha proteobacterium HTCC2255]
MSN---------------------------------------------------------
----------------------------------------------------DDSDEHII
EHSAAPLIEHLAELRTRLIYSVLAFVVAMLLCF--SFARPLLF-FLLEPTAKILLS----
------------------------YGQAPDFTTFAAQENFFVYFRISVLMGFGLSFPIIA
FQLWRFVAPGLYKNEQGAFLPFIIASPLLFLAGASFAHYVVSPLAMNFFIGFSDFGTDGT
KVAIEGTQRAVFVPRVTDVLDLTLKFIFAFGLCFQLPVLLTLLGMGGIVSSQSLRDMRKY
AVVGILVLAAIVTP-PDVITQVILFVVVYMLYEVSIWLVRMVEKKRDKQLAEDGY-----
-----------------------------FDNDL--------------DDE
>gi|114798916|ref|YP_760633.1|	   275 residues, 50 /line  Sec-independent protein translocase TatC [Hyphomonas neptunium ATCC 15444]
------------------------------------MNQ------LPPKDEQ--------
----------------------------------------------------PEILDDEV
ESSRAPLLTHLIELRGRLIKILLALGTATIFAF--FFADQIYN-LLVAPFASMAED----
---------------------V--RGSKLEFIFTAPMEFFFAKLKLALFAGVFLAFPVIA
WQVYAFVAPGLYKNERGAFWPYLVFAPLLFSLGAAFVYFIMLPMLARFTISMEQV--DAA
QTT------IKMMPRVSDYLALVMSLMLAFGISFQLPVILTLLAKIGIVTSEGLGKGRKY
AIVGILAFAAVFTP-PDAISQLLLAVPVYCLYEISIFCVRLIEKKAEKEEAATAA-----
--------------------------------------------------E
>gi|116251808|ref|YP_767646.1|	   275 residues, 50 /line  putative Sec-independent protein translocase protein [Rhizobium leguminosarum bv. viciae 3841]
------------------------------------------------------------
-------------------------------------------------------MSGDI
EDKPQPLIEHLMELRTRLMWSIGAFFVAFIACF--FFAKNLFN-YLVIPYKTAVQW----
---------------------ANLDVEKAQLIYTAPQEFFFTQVKVAMFGGLVVAFPIIA
AQVYKFVAPGLYKNERQAFLPFLVASPVLFLMGGALVYFFFTPMVMWFFLSMQQAP-GHD
EIA------ISLMPKVSEYLSLIMTLVFSFGLVFQLPVITTLLARVGLLTSQWLAEKRKF
AIVLAFVVAAVLTP-PDPMSQIGLAIPTILLYEISIYAARLVERQRARQAVEKETGS---
------------------------------------ADVAKTDS------V
>gi|116748139|ref|YP_844826.1|	   257 residues, 50 /line  Sec-independent protein translocase, TatC subunit [Syntrophobacter fumaroxidans MPOB]
------------------------------------------------------------
-----------------------------------------------------------M
TTDKMPFTQHLEELRRRLVISAIAVGLGFMICY--AFKEMLFE-VLMKPWIEALP-----
------------------------KGQGAKLIYTAPHEAFFTYMKVSLLGGTALAVPVIL
YQVWRFVAPGLYENEKKYLLPIVFASSVFFLGGASFGYFFVFPVGFQFFTSFASDF----
---------ITPMMSTREFFSFSIRMLLAFGLVFELPVFMFFLARLGLISSDYLRKKRRY
AIVIIFIIAAAVTPSPDVFSQCLMAGPLILLYEASVWIVYCFGKKEKRSAGTEEETAEST
--------------------------------------------------T
>gi|117924915|ref|YP_865532.1|	   271 residues, 50 /line  Sec-independent protein translocase, TatC subunit [Magnetococcus sp. MC-1]
------------------------------------------------------------
--------------------------------------------------------MNLD
VEQKAPLVEHLIELRNRLMISVGAIIVGFILCY--SFSEQIFE-FLAAPLHEIL------
-------------------------GPQAKMIYTALHEAFFTQIKVSFFAGLFLAMPVLF
TQMWLFIAPGLYQHERSAILPFLFVTPVLFFMGGTLAYYFVFPLAFKFFLGFQSST----
---------IEALPSMREYLSLVIKLIIAFGITFELPVGLLLAIKAGVVSTAGLVDKRKY
NIVLAFVAAAILTP-PDPFTQVMLAIPIMLMYEISIFFGRGIERKRAEQEAAEEAQW---
----------------------------AADHNV-----DDDDVDHPEHKA
>gi|121534139|ref|ZP_01665964.1|	   258 residues, 50 /line  Sec-independent protein translocase, TatC subunit [Thermosinus carboxydivorans Nor1]
-----MA------------------------------------ETKPGLQDE--------
------------------QAGA--------------------------LPQTEAQAADTD
GGAEMSLIDHLEELRRRLIISLAAVAAGSIVCY--FYAQELVH-YITAPA----------
----------------------------GKLYYMNPAEAFFTYLKVSFFAGFLLALPVVL
YQMWAFVVPALTKRERQASLILVPASLALFFLGLAFSYFLVLPAGVKFFIGFATED----
---------LQPMFSIGQYLSFVISFLLPFGVIFELPLLIFIMAKFGLISSAYLVAKRKI
MLVMAFVVGAVISPTPDVFSQTMVAIPLLLLYEISILVVKYILRK---------------
---------------------------------------------------
>gi|124515082|gb|EAY56593.1|	   252 residues, 50 /line  Sec-independent protein secretion pathway component TatC [Leptospirillum sp. Group II UBA]
------------------------------------------------------------
---------------------------------------------------------MPV
DPKASPLWGHIVELRQRVLRSLFWLALFMGVSF--PFSDRALK-YLGAK-----------
--------------------------AGVPLVFTTPTEAFWVTLKVSLFMGAVLGYPFVL
YEIWRFVSPGLYRREKKSVFLWILGGTLFFALGVAFSNFVALPSALHFLVGFGQKE----
--G------LQAFMSVDRTVAFELRFLFVFGLIFELPLLMALASARGWITPEKFRKGRRW
ALVGNAVAASILSPTQDFLNMMIMFVPLVILYEAGILFSLLTARKGQKKVSTVSSRSR--
------------------------------------------------VSL
>gi|12831976|emb|CAC29149.1|	   267 residues, 50 /line  TatC protein [Pseudomonas stutzeri]
------------------------------------------------------------
------------------------------------------------------MSKSSI
NDQEMPLVAHLTELRKRLLHCVVAIGLLFAGLF--YFSQQIYA-LVAAPLRAYLPE----
---------------------------GATMIATGVASPFLTPFKLTLMVALFLSMPVIL
HQIWGFIAPGLYKHEKRIAVPLLVSSIFLFYAGMAFAYFVVFPIMFGFFASVTPEG----
---------VAMMTDIGQYLDFVLTLFFAFGVAFEIPVATFLLIWVGIVDVATLRKSRPY
VIVGCFAVGMVLTP-PDVFSQALLAVPMWLLFEAGVICGRLIKKRDEHFRGDADDD---A
PDASDQP---------------------------------------PASRP
>gi|139439560|ref|ZP_01772992.1|	   256 residues, 50 /line  Hypothetical protein COLAER_02019 [Collinsella aerofaciens ATCC 25986]
------------------------------------------------------------
------------------------------------------------------------
----MPLFDHLGELRRRLTIVVVSVFAAAIVLY--FATPVVLD-ILEDPIRSFVP-----
---------------------------DGKFYITTTLGGFGLRFSLAIKMAVVMCTPMII
WQILAFFLPALRPNERKWVVPTVLASTVLFFLGAIFCYFIIIPAGFEWLIGETSAV----
---------ATALPDLENYVNMELLFMIGFGVAFELPLIIFYLSVFHIVSYAAFRGAWRY
VYVGLLVGSAVITPDGSPVTLGLMYGALLSLYEISLAIARVVITAREGKEGLFVSRLDLF
SDDED--------------------------------------DE-----E
>gi|146326257|dbj|BAF61400.1|	   273 residues, 50 /line  sec-independent protein translocase protein TatC [Candidatus Vesicomyosocius okutanii HA]
------------------------------------------------------------
-----------------------------------------------------------M
INKEMTFVQHLVELRKILLHSVIVILIIFMSIF--PFANEVYS-FIAAPIINVLP-----
--------------------------QDTNIIAIGIISPFLTPLKMSLIISVYVAMPYLL
YKIWSFIAPALYKHEKQMILPLVVSTTILFYAGLLFSFYIVFPVIFGFLSSIGPNI----
---------VDFTPDIQYYLDFVLKVSFAFGVAFEVPIATILLIIFGITTVEKLKNNRPY
IIIGAFILGMLLTP-PDIISQTLIAIPIWLLFEAGLIFSPLFKQNKQEISNNY-------
-------PKNSNKTNSKE-----------------KKVSDNDDWNKNKIEN
>gi|147830798|emb|CAN01739.1|	   250 residues, 50 /line  Sec-independent twin-arginine protein translocase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
------------------------------------------------------------
------------------------------------------------------------
----MSLVQHLLELKKRLFIAGVAIILAMVAGW--FLSSFVLE-ALRQPIETINAE----
------------------------QGRNASLNFPTITSAFDLRLQIALYVGLIISSPVWL
YQVFAFLVPGLTKTERRYTFGFFFSAVPLFLAGCAAGWF-VLPHIVALLTQFAGAG----
---------DSSFITAREYFDFVLKLVFAVGIAFVLPVFLVLFNFMGILSGATIIKSWRI
AILLIILFCAIATPAADVMSMFLLAVPMTLLYLVAAGIALLNDRRRARKAAAMTDD----
-------------------------------------------LLS-----
>gi|15606489|ref|NP_213869.1|	   240 residues, 50 /line  hypothetical protein aq_1267 [Aquifex aeolicus VF5]
------------------------------------------------------------
------------------------------------------------------------
----MPLTEHLRELRYRLIISIIAFLIGSGIAF--YFAKYVFE-ILKEPILKSYP-----
---------------------------EVELITLSPTEPLFILIKISLAVGFIIASPVIL
YQFWRFIEPALYSHEKRAFIPLLLGSILLFMLGALFAYFIVLPLALKFLLGLGFTQL---
--L------ATPYLSVDMYISFVLKLVVAFGIAFEMPIVLYVLQKAGVITPEQLASFRKY
FIVIAFVIGAIIAP--DVSTQVLMAIPLLLLYEISIFLGKLATRKKKEIQKA--------
---------------------------------------------------
>gi|15611432|ref|NP_223083.1|	   249 residues, 50 /line  hypothetical protein jhp0364 [Helicobacter pylori J99]
------------------------------------------------------------
------------------------------------------------------------
--MFEDLKPHLQELRKRLMVSVGTILVAFLGCF--HFWKNIFE-FVKNSYK---------
----------------------------GTLIQLSPIEGVMVAVKISFSAAIVISMPIIF
WQLWLFIAPGLYKNEKKVILPFVFFGSGMFLMGAAFSYYVVFPFIIEYLATFGSDV----
---------FAANISASSYVSFFTRLILGFGVAFELPVLAYFLAKVGLITDASLKAYFKY
AIVVIFIVAAIITP-PDVVSQIFMALPLVGLYGLSILIAKMVNPAPKDNENDHENDAKE-
--------------------------------------HTKSE-------S
>gi|21233513|ref|NP_639430.1|	   245 residues, 50 /line  sec-independent protein translocase [Xanthomonas campestris pv. campestris str. ATCC 33913]
------------------------------------------------------------
------------------------------------------------------MSLFDD
AQAESSLIEHLVELRSRLVRALIGLGVVLIALL--PFSRTIYS-WLAAPLISQLPL----
---------------------------GQTMIAMNPAGAFFAPLKLTFFVAVFFSVPWLL
YQAWAFVAPGLYQREKKLAFPLLASAVALFYIGCAFAYFLVLPAVFHFLTTFKPDV----
---------IAITPDANSYLDFVLAIFFAFGASFELPVALVILVLMGWVSPKQLSEGRGY
AIVGIFVLAAVLTP-PDVVSQLMLAIPMCLLYELGIIASRAVAPKAS-------------
---------------------------------------------------
>gi|27262426|gb|AAN87494.1|	   249 residues, 50 /line  Sec-independent protein translocase protein TatC [Heliobacillus mobilis]
------------------------------------------------------------
----------------------------------------------------------MT
DEKTMPLMEHLEELRGVLIWSLAFALAGTMITY--YWNQDLIA-LITKPLTDL-------
---------------------------GIKPVILRPAEGFFTSVKISFFAGLIVAAPLIF
WKIWSFIVPALYPNERKWVYIVLPFSVFLLVTGILFAFYVVYPIAVTFLITFGD------
---------FTPMISISEYLSFALWFILPFGLIFQLPLVIMFLVRIGIIDHHFLKKYRKH
ALLIMFVVAAVFTPTPDVVSQTLMAGPMYLLYEISIWVARFIQPKKTTEEQSIESQDM--
--------------------------------------------------Q
>gi|42525186|ref|NP_970566.1|	   253 residues, 50 /line  sec-independent protein translocase protein [Bdellovibrio bacteriovorus HD100]
------------------------------------------------------------
------------------------------------------------------MRREEL
DSKAQSLYEHLSDLRKCLINCVWILLIATGICY--GFSEKIFD-FVREPIRPYLP-----
---------------------------GGGLIYTGPLDKFIAHLKLSFVCGILLSCPFWL
YQVWKFIAPGLYAKERKYTMGFIFSGTGLFVLGAAFSYWIALPMAFQFLMTYGGEV----
---------DKPMISIDQYMGFFTQMCLMFGVAFELPLVIVVLGMMGIVSQSFLRKNRRY
AIMTIATIAAIITP-PDLLSMVMMLAPMWVLFEAAVLIVGIFEKKREDAYAVNER-----
--------------------------------------------------E
>gi|55980356|ref|YP_143653.1|	   246 residues, 50 /line  Sec-independent protein translocase protein TatC [Thermus thermophilus HB8]
------------------------------------------------------------
------------------------------------------------------------
-MKEAPLVEHLEELRARILWSLLAWAVGTGVAW--TFRVQLLE-WLKRPLDLAAKA----
------------------------HGIQVNLIVLDITEPFLVSLKVAAFGGLVLALPFIV
YQVWAFIAPGLYEHEKRLAVPFLLGAGFSFALGALFAYYAFLPFAVPFLLGFLGDV----
---------VTPQISIGRYMGQILMMLTVMGVVFEMPVVSYLLARLGILTSSFLARNWRI
AVVLLLTLAAVITPTVDVVSLFIVSGPLLVLYWVSVLVARLAERQRPQEAA---------
---------------------------------------------------
>gi|56418779|ref|YP_146097.1|	   247 residues, 50 /line  hypothetical protein GK0244 [Geobacillus kaustophilus HTA426]
------------------------------------------------------------
-----------------------------------------------------------M
NDKEMSVYEHLGELRKRLIIVLIFFAAALVVSF--FFVDDVIL-YLQRTAEA--------
--------------------------KHLTMNAFRLTDPIKVYFQFAFVIAAVLSAPVLL
YQIWAFVSPGLYEKERKVTLSYIPASIVLFLAGVSFAYFVLFPFVVRFMSQLADQL----
--G------VQQMIGINEYFQFLLQLVLPFGIVFQLPIVVLFFTRLGLITPQLLVRIRKY
AYLALLILAAVITP-PDVLSQVIVMIPLTILYEGSIWVARIGYRKAQRAVEQEGN-----
--------------------------------------------------E
>gi|67939306|ref|ZP_00531812.1|	   288 residues, 50 /line  Sec-independent periplasmic protein translocase [Chlorobium phaeobacteroides BS1]
MSSET-------------------------ESSRPK---SPASRLMDTELE---------
------------------------------------------KKDAISRELVEPEEEENT
DDNGMHFIEHLDELRGRLIKSTIALVVVMVACA--FFSDILVNQILIAPLKNS-------
-------------------------GDNIILQNLVPYGQISLYLQVIFFSGFILAFPFLV
NQIWQFVLPGLKESERSATKFVISFISLSFFAGIAFGYFVFLPISLKFFAGFGTSL----
---------IENNIAVQDYVSFFIGALLTAGLVFELPFISYVLSKIGLLTPAFMRFYRKH
AIVTLLIIAALVTPSTDLVTQLVIAIPMILLYELSIGISGYVNRKNSALTSSS-------
--------------------------------------------------K
>gi|71066556|ref|YP_265283.1|	   278 residues, 50 /line  twin-arginine translocation protein TatC [Psychrobacter arcticus 273-4]
--MDLFKRQKIRLEKVTDSAIEGETETTKND-----------------------------
-----------------------------------------------------DSGDILS
PLADMPITEHLIELRRHLIKICVAVLVIFLALV--GFSRELYD-FLSNPLVAQLPA----
---------------------------NSTMIATDITSNFMAPIRLTIFVAAFFAMPYIL
YQIWSFVAPGLYKKEKKVAIPVLLSSIFLFYSGVAFAYFIVLKGVLKFFIMFAPQN----
---------VLPMTDIDSYLSFALKLFMVFGLTFEIPVVTLLLILVGIVSIQSLQDKRRY
IIVGCFAVAAVVTP-PDGVSMLMLAIPMWLLFELGLFLAKILIKEDRNLA----------
---------------------------------------------------
>gi|71083669|ref|YP_266389.1|	   254 residues, 50 /line  sec-independent protein translocase protein tatC [Candidatus Pelagibacter ubique HTCC1062]
------------------------------------------------------------
---------------------------------------------------------MTK
SENEGGFVSHLTELRKRLIHSFIFLFIFFIGCY--FFSEHLYG-FLVEPFAKAVNE----
------------------------SGTDRRLIFTALQETFLTYLKVSFFAAFFVTCPYIL
VQIWKFIAPGLYKHEKIAIVPYLVLTPILFFLGGMLVYYLIMPLAIKFFLSFESTG-AST
GLP------IQLEAKVSEYLSLVMKLIFAFGISFQLPVVLSLLARVGIVDAEFLRKKRKY
VVVMIFAAAALLTP-PDPITQIGLAIPLLILYELSIFSVNIIDKKNKKNA----------
---------------------------------------------------
>gi|73749373|ref|YP_308612.1|	   262 residues, 50 /line  Sec-independent protein translocase TatC [Dehalococcoides sp. CBDB1]
---------------------------------------------MSTKNETPEV-----
--------------------------------------------------EEEEPPEEVK
AKGKMPIGGHFNELRQRFTRGIIALVVGVMAAF--FFATPIIG-FLTAPG----------
-------------------------GPDFKPAQLGVMEYASVFFNVSLWAGFILASPYIL
YQLIAFITPALNRNEKKFIFISIPAVTVMFLAGLAFAYYVALPPALNILLHWGDDV----
---------VLTVVGIKDYMNVVTRILIALGLIFETPFIIMVLARLGVVSPKWLASKRKI
WVVIAFVIAALITPTFDPVNQTIMAGPLIVLYEISIWLSKLVYRKKREVIES--------
--------------------------------------------------K
>gi|75756303|gb|ABA27198.1|	   295 residues, 50 /line  thylakoid protein translocator TATC [Bigelowiella natans]
------------------MIKNARFSISISRNIFLQKNNQKLLITK--------------
---------------------------NNRNSIINKSKKIFFKKKSHHEALCIPDQILDN
QIQKQTVNYHIDELRERILISIINIFLSFCICL--SISKDLLI-AFE-------------
---------------------INGLKNNYSFLQLNPGEFFFTSLEIAINFGIICSFPSLV
YQISSYTIPGLTKNEKNFYIPIILGSIFLFVLGLIFSYYILSPFALNFFSTYSDGL----
---------VESTLSIKQYFDFYIKLMFSTGIGFQIPIILVILGKSKLVTSNQMLSQWRY
VIIICSIAAAVITPTTDPVTQLITCLPLIGLYFLGVFLTKLSEN----------------
---------------------------------------------------
>gi|76258661|ref|ZP_00766315.1|	   261 residues, 50 /line  Sec-independent periplasmic protein translocase [Chloroflexus aurantiacus J-10-fl]
MTTR--------------------------------------------------------
-----------------------------------------------------PARANRA
DDASMTLVEHLIELRSRLIKSGIAVLIGMVLGFVAVWPQGPIK-LIDILILTFAPI----
------------------------NDRFAPIQSVGTTEQFTSYMKVALLVGVILAMPVIV
YQILAFIIPGLTDSERRLIYRALPFVTLFFLAGIAFGWFVTTPVALQFLIGFSDSP----
--L------IQTQPTLSDFLETVSMLLLINGIVFELPIIIYVLAYLNVTTARQLAGYRRY
ALVIVIIIAAFITPTGDPVNLMLLALPMYLLYEVGIILARFVPNAKPKTAA---------
---------------------------------------------------
>gi|78356513|ref|YP_387962.1|	   368 residues, 50 /line  Sec-independent protein translocase TatC [Desulfovibrio desulfuricans G20]
MSDELKRDGQTGDSEEHETAANGETGTSTADAGQGDTNEQPAAEQQDTAADSTPGDGTDA
DTGDAAADDPSAESADDNNKAG-----AENAPALSES--VPPVPAVNRVTEAAADEEEDE
DERPMTLLEHLDELRFRLVRCCIAVGIGFLACY--GFAEQLFG-YLVAPLLAVMPE----
---------------------------TSTLIFTELPEAFFTYLKISIVAGMFLTSPYIF
YQIWAFIAPGLYDEEKKYIIPMAGVSALFFASGACFGYFIVFPFAFDFFMSFNNET----
---------IQAMPKLGEYLGFSLKLLIAFGLIFEMPLFAFFGARIGILTAAAMRKARKV
AVLCFFIVAAILTP-PDVISQLLMAGPLLLLYEVSIYVAQIFGRSAKAGGQDEDENDEQE
---------------------------------------------E---TA
>gi|83311621|ref|YP_421885.1|	   274 residues, 50 /line  Sec-independent protein secretion pathway component TatC [Magnetospirillum magneticum AMB-1]
------------------------------------------------------------
-------------------------------------------------------MSDSH
DDKTMPLLEHLIELRRRLIWSAIAFIVAFGICY--YFSNEIYE-FLLEPYSKAALA----
------------------------KGGNRRLIYTAPTEAFFTFMKVSAFAGAALCFPIWA
GQLWAFVAPGLYKHEKQAFLPFLVATPVLFALGASMVYFLVLPNLYTYLLGFENLVGGPS
TLP------IQMEAKVNESLSLIMTLIFAFGLAFQMPVLLTLLARVGLVTAAGLADKRRF
AIVGNFVFAAVVTP-PDVVSQLSLAIPMVGLYEISIISARWAEKKREQALNDDGEDD---
------------------------------------ATHDDTDFNA-----
>gi|83590127|ref|YP_430136.1|	   247 residues, 50 /line  Sec-independent protein translocase TatC [Moorella thermoacetica ATCC 39073]
------------------------------------------------------------
-----------------------------------------------------------M
EDKSMTLTEHLEALRRVLLVSIIALVIATIAVYF-GFREQLLA-LILRPMKDL-------
---------------------------GIKPVFITPWEAFFTTIKICFVAAIFLALPVIL
WEVWSFVLPALHSHERRLVYILMPASIILFVGGVVFGYLVVFPAAVRFLLVTASEG----
---------FMPFITISRYFGFLSMFVLPFGAVFQLPLIIMLLTHLGLVTPRFLAKNRKY
AVLIIFIVAAVVTPTPDMVSQTLMALPMVVLYEASIWISYLVRRKREEKVRQEG------
--------------------------------------------------I
>gi|83593106|ref|YP_426858.1|	   323 residues, 50 /line  Sec-independent periplasmic protein translocase [Rhodospirillum rubrum ATCC 11170]
MAP----ADATR------------------------------------------------
------------------------------------------------------DEDSDL
EDKKMPLIDHLIELRSRLLWSTVFFLVAFFACF--AYAQEIYN-ILVLPLARVMER----
------------------------VGGSQRMIYTALTEAFFTYVKVGAFGAIVLSFPLIA
TQIWMFVAPGLYRHEKRAFLPFLIVSPMLFILGAAMVYYLVMPMAWSFLLGFQTTRE-QT
VLP------IQLEAKVGEYLGLVMKLILAFGFSFQMPVALTLMARVGLVTSRGLAKARKY
AIVAVFAGAAVITP-PDIMSQVMLAIPLLVLYELSIVAARMVEKSKGIEDDDLENLDDDE
PPPAAAAPSTAHKRGGTTALAAPLARDEEAGADGDPGRFEETDWNH---GH
>gi|83858682|ref|ZP_00952204.1|	   266 residues, 50 /line  TatC, Sec-independent protein translocase protein TatC [Oceanicaulis alexandrii HTCC2633]
MST----PE---------------------------------------------------
-----------------------------------------------------LEHEDEV
EASRAPLMAHLEELRDRLIWAMGAVVIGFVICF--VFAEWIYN-VLLVPFENAARQ----
---------------------VRGDALDLQLIFTAPLEFFFVKLKLALFGAIVLAFPMLA
YQVWAFVRPGLYKNERLAFAPFLLASPILFAAGMAFVYYVILPFVMSFALGQEQIGQ-EG
RAS------IQLLTRVSEYLNLVTTLALAFGISFQLPVLLSLLGKAGIITSGDLIRFWKF
ALVGIAAFAAFVTP-PDPISQLFLGAAMFGLYALSILAVKLVERKPDEDA----------
---------------------------------------------------
>gi|85860812|ref|YP_463014.1|	   277 residues, 50 /line  sec-independent protein translocase protein [Syntrophus aciditrophicus SB]
---------------------------------------MP-------------------
----------------------------------------I-----------QELPMTLP
ADEKLPLTSHLEELRKRLIHVFIALGIGFTLCY--MFKDWLFF-VVTRPLIAVMPK----
---------------------------NSFMIFTSLPEAFFTYMKISFFSSLILTSPYIL
YEIWKFVSPGLYPKEKRYVLPFVFFSTLLFAGGVLFGYFIALPPAFKFFVSFSSDF----
---------LKPMVSMREYLSLALKFLLAFGLCFELPVFVFFLTKVGVINARMLSSQRRY
AILIIFIVAAVLTPSPDAVSQILMALPLMVLYEVSILVSRLAGRKRRGTLEETGNEIDRK
EEE------------------------EDIPET---PKA-----------E
>gi|88607734|ref|YP_505046.1|	   241 residues, 50 /line  Sec-independent protein translocase TatC [Anaplasma phagocytophilum HZ]
------------------------------------------------------------
------------------------------------------------------------
----MSLAGHLKELRRRVLFSIAFFVLVFIACY--FFSEKIYE-FLLVPLVDLEG-----
------------------------DNEDFSLIYTDLTEAFFVYLKVGAMAALFCSFPMFA
WQFYMFLAPGLYKAEKCILIPYLIAAPVLFVTGAAGVYYYIFPLAWKFFIKFENRDS-SV
GVP------IEFMPSVSEYLDLVLQLMFAFGLAFQLPVILTLLARVGVISAQSLVSKRRI
AIVVIFIVAAILTP-PDILSQIGLAVPMLLLYEASIIACRYIEKR---------------
---------------------------------------------------
>gi|88940623|ref|ZP_01146058.1|	   268 residues, 50 /line  Sec-independent protein translocase TatC [Acidiphilium cryptum JF-5]
MTS----DETETP-----------------------------------------------
------------------------------------------------------QDADPI
NDKEMPLLDHLAELRRRLLWSGLAFLAAFLVSY--YYAQPIYH-FLAQPLVNILKE----
------------------------RGQKPELVYTALYEAFFTYVKVAIFAAAFISFPVIA
TQIWLFIAPGLYRSEKRALLPFLIATPVLFFAGGALAYYVIFPNAWKFFLSFQTNPH-NA
NFQ------INVLPRVSDYLNLVMKLIFAFGICFELPVLLTLLGRVGIVNAAALKKYRRY
AYVGCFIVAAILTP-PDVFTMTGLALPLIALFELSIFAVKMVEPKAEVSEN---------
--------------------------------------------------A
>gi|89894980|ref|YP_518467.1|	   250 residues, 50 /line  hypothetical protein DSY2234 [Desulfitobacterium hafniense Y51]
------------------------------------------------------------
------------------------------------------------------MRRRKR
VDENMPLMEHISALRKVFLFAAYGVILGTVVGW--IYSDQVYA-FLANPVIQL-------
---------------------------GIELITTTPMEPIMVKLKVSIVVGVVIALPIII
WQIWSFILPALKQNEKKYLYMIVPSSVILMLAGIAFAFLFVIPIGLKFLLFTGQAVV-T-
---------STTLVTKASYLSFIIRFLLSFGLIFQLPVILLLLIRIGVLSPDSLAKKRKY
AFFGIVVVVMLISPTPEIMTQGLMVLPTYMLYEASIWLGYIVARKREKALE---------
--------------------------------------------------G
>gi|94969707|ref|YP_591755.1|	   271 residues, 50 /line  Sec-independent protein translocase TatC [Acidobacteria bacterium Ellin345]
------------------------------------------------------------
----MPSPTIDP----------------------------A-----------IRARLSQE
ALKGMSFLEHLEELRRRIIWTFVYIAAGFGVCW--WWHEQIYD-FMQRPIMKALAA----
------------------------NHLDQKLVYLNPTEPFNMYLKMAFIAGLFVASPFVL
YQVWLFIAPGLYKRERRYVLPFMFSTVLLFLGGGVFGYYMVYPNALTFLIGYSHQ-F---
----------SPMITISEYTDLFLTIILGLGIVFEMPILVFFLALMGIVSAGWMWRNLRY
SILVIFVIAAIITPTTDIMNMCVFAAPMILLYILSIGVAFLVHPKNRRKRREAQEA----
---------------------------QE---------------------G
>gi|94986064|ref|YP_605428.1|	   256 residues, 50 /line  Sec-independent protein translocase TatC [Deinococcus geothermalis DSM 11300]
------------------------------------------------------------
-------------------------------------------------------MRQEP
DLKTAPLLDHLEELRKRIIISLVFLAIGLVIAF--QYRLQLIE-LVKMPLQASEQY----
------------------------QKGHVTVVTQGLTDQFFLALNLSFWAGLALALPFIL
WQVWAFIAPGLYPHERRWALPFIVGAGLSFLAGAVFGYKLVLPAMVGFLLDFLAGAV---
----------TPLLNLRDYIGTVTTFLVAFGLAFELPILAVILTRIGLVNHVMLRRAWRF
ALVGVAVAAAIITPTPDPGNMLLVAVPLYALYELGVLLSRVFRVVPAEEA-----P----
---------------------------AIG--------------------A
>gi|94987030|ref|YP_594963.1|	   315 residues, 50 /line  Sec-independent protein secretion pathway component TatC [Lawsonia intracellularis PHE/MN1-00]
MSD----SGAIKDTDSNMLL---------------DSSQEKFVESMHGEQEQAYLPGITP
PVNNTSLIITASGNGGNNNGGG-----------------IP-----------PTMSDDDE
KPYGMPLLEHLSELRKRLTKCIIVIGVVFITCY--SISDILFH-YLALPLITVM------
-------------------------PADTKLIFTSVPEGFFVYLKIAFVAALFITSPYIF
YQIWLFISPGLYDEEKKYILPLSICSAAFFLGGAAFCYFFVFPFVFVFFMSYSTDTI---
----------VAMPSLSNYLSFSLKMLVAFGLIFEMPLFAFFLGKMNLINAEKMRSIRKY
AILVVFIVAAILTP-PDVFSQILMAIPMLILYELSIWVVALSAGHKEKRK----------
---------------------------------------------------
>gi|98662850|dbj|GAA00261.1|	   281 residues, 50 /line  unnamed protein product [Pelotomaculum thermopropionicum SI]
---------------------------------------MRFLR----------------
-LFNRRCFITNG----------------------------F-----------HGGRKLAK
KTEEMSIIEHLEELRRVLIISILGTFVLAVAAY--FYIDKILA-VLLEPLTS--------
--------------------------SGNKIIFTGVTEAFFVKIKLSVFIGFLAALPVIL
WQVWSFIIPALKKNERFYFTLFVVLSFICFIGGIVFSFFGVYRLGVMFMLRFAGPEL---
----------VPMLTIDKYISFTITFLLPFGLVFELPLISFILARLELINYRFLAKNRRY
ALLIIVVAAAVLTPTPDVITCLIVSGPMYLLYEASAWIVRIVERGTARRKRREELA----
---------------------------ELAGAR---AAD-----------T
>gi|11465730|ref|NP_053874.1|	   254 residues, 50 /line  hypothetical protein PopuCp079 [Porphyra purpurea]
------------MSLEPQNNLL--------------------------------------
------------------------------------------------ANINTNSENLPE
NDVPMSITEHLEELRQRTVFVFIFFLLAATISF--TQIKIIVE-IFQAPAI---------
---------------------------GIKFLQLAPGEYFFSSIKIAIYCGIVATTPFGV
YQVILYILPGLTNKERKVILPILIGSIVLFIVGGIFAYFVLAPAALNFLISYGADI----
---------VEPLWSFEQYFDFILLLLFSTGLAFEIPIIQLLLGISGTVSASQMLLAWRY
IIIISTIIGAVLTPSTDPVTQIIMSSAVLALYFSGVIILFLLRK----------------
---------------------------------------------------
>gi|71842243|ref|YP_277331.1|	   255 residues, 50 /line  hypothetical chloroplast RF43 [Emiliania huxleyi]
------------------------------------------------------------
----MASAFSSQ-----------------------------FRQKYG----IFPVRTNSV
TDDEMALSEHIEEFSQRLIFCLVLLTCTTLLCF--IDVKEIVR-IFQAPAE---------
---------------------------GIKFLQFSPGEYFFASVKIAFFGGILISSPVVI
YQILLYTLPGLTKKERDVILPMTIGSGVLFSGGLWFSYAFLVPAALKFFIAYGSDV----
---------VEPFWSFDQYFNFVAVLIFSTGLAFQVPVIQIVIGLLGIISGKMMLSSWKY
VIVISTILGAIITPSTDPITQILLSGALLALYLSGAGVLILLKK----------------
---------------------------------------------------


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.