FANDOM


>gi|22325405|ref|NP_671761.1|	   249 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------MESVGSSPF-VGRNIPT-FSNAEA
-IERGMPFFNNLRVPWTLLFQASSEERREAEGFLSCVES-RHKE-----YREMLRY--YD
ERRSDIARK-MAMLESHPRHWLKNGFQLLAPMPGILLSYCE-------------------
----------------------------------------------------------DC
DRDAAAVSKEKHPTIIADGDFIPRTPSLFYL---------GPAATDADTTECQNFVN---
---QDQCRELQYFRTKKRRVDFRLEELETLIAKLKKKRRRVVTRLDEVEQTIRALEIRSE
DWEKAGLQLVWPM-----------------------------------------------
---PDRLLQDNRTVSDRAI>gi|10177795|dbj|BAB11286.1|	   181 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
MSGSQVSRGT--------------------------SSDSDDELDSSSTSIRGYFGCPRR
D--------------RSPSPICVVEDRVIRRPALPVGEPLYPWRRPPLIAASPSFTPVGR
DFVPGSVKYPA------DLLRHLHPEEAARFRYWFRTLEGQHRAYCRRH-------AELL
RMMQEMELG-MRRLEADPKDWERFGLGKLNPLPPFLRAYC--------------------
------------------------------------------------------------
------------------------------RAKL--------------------------
--HEDE------------------------------------------------------
------------------------------------------------------------
------------ASSSRGP
>gi|22327286|ref|NP_680307.1|	   248 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------MENKGASTVCPLDPGSPLF-----
--------FPH------AAFHFPPKDKKEAYDFIDKAVS-RPQKA----NARGLHR----
--------------------------SCRKEGSRLCSGCIYARDQVLGPVNAPVEVIPSD
SEEDDDEDEDSNPWKRVKN----DKKNEASNSNLEPAMKELGKLDGVSVSANNFDLKWDC
DLEGVGMMDEDIPNV---PDRKPSPPRDFFRSQIRAPCALIKELSDRDQEIAMAFIKDLA
VQHQKRS-------LEKKKLQKKINQMLRRVTAISRE--------------LHTLNT---
------------------------------------------------------------
----------ILDLASQGV
>gi|15235823|ref|NP_192517.1|	   198 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------MANEGVSLICPLDLGIPLFLY-GD
SFDPTSVLFPH------YVFYFPPKDKKESYDFADKVIE-KHRRACDERQHLGLKRQTLE
ARIAQMERK----------------------------MYLGSQGRVPDPNRVPVKVIPFD
SEEG-DEEEDINTWKRVKTNPRWATKPRRPLQNME-------------IDLYSTETVPDH
SA--DGMIREEVPKV---PDQRPPLPRGYFRSEIWTPCTLIKDLPERDQ-----------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|15232062|ref|NP_189760.1|	   100 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------MENEGASTVCPLDPGSPLFLS-GD
GFEPVGVLFPH------AVFHFPSKEKKEAYDFMDKVVD-KHRRLCDERQRLGLKNES--
------------------------------------------------------------
---------------------EVDVKNEGSTSNPE-------------------------
-----PAVKEPVPE---------PL--------P--------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|22327356|ref|NP_680338.1|	   160 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------MENEGASTVCPLDPSSLLFLS-GD
GFEPAGVFFPH------AAFYFPPKDKKEAYDFMDKVVD-KHHRMCDERQRLGLKRHTLE
AHIARVERKELRLCRKDP--------DYAPDVPLRLRSSFGAC-----------------
----EYSGRDMDFNLRC-SESMPDFSRVGITDGDV-------------------------
-----PNVPGRRPS---------PP-RGFFRFQI--------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|15229228|ref|NP_189901.1|	   194 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
----MIA--------------------EIYLDNTYKMERERACTVCPLDPGSPLFLS-GD
GFEPTGVLFPN------AFFHFPSKDKKEAYDFMDKVVD-KHRRLYDERQRLGLKRQTLE
ARIARIERK-IRAMESDPFQWEWRNFDCVAKIPHMLRMYLRARGQVSGPVNAPVQVIPSD
SEDSDDEEEDSNPWKRVKNEPDVDVKNEASTSNPE-------------------------
-----PAMQEPVPE---------PL--------P--------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|15232048|ref|NP_189759.1|	   148 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------MENEGASTVCPLDPGNPLFLS-GD
GFEPASVLFPH------AVFHFPLKDKKEAYDFMDKVVD-KYRRLCDERQRLGLKRQMLE
ARISCVERK-VRSMESDPFQWDWRNFDCAAKIPHMLRMYLRARGQVPCPVNAPVEVIPSD
SEEDNDEEEDSNP-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|29648907|gb|AAO86828.1|	   132 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------MDKVVD-KYRRLCDERQRLGLKRQTLE
TRIARIERK-VRAMENDHFQWEWRNFDCVAKIQHMLRMYLRARGQVPGTVKAPVKVIPSN
SEDGDDEEEDSNPWKRVKNEPDVDVKNEVSISNPE-------------------------
-----PAMKDPVPE---------PL--------P--------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|7267370|emb|CAB77931.1|	   263 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
MELIQGAIVFIQTEKTRTELESDIKEYEINLLLLGQTHDEDFSEDQESDPVEPEVSIMPL
ETPTLVAIPTEIPPPTNTETVVIEDDDEIYLVNTSRKENERASTVCPLDPVSPLFLS-GD
GFEPASVLFPH------AVFHFPAKDKKEVYDFMEK--------------RLGLKRQTLE
ARIARIERK-VRAMESDPFQW--RNFDCVAKILHMLRMYLCARGQVPGAVNALVQVIPSD
RKEDDDEEEDNNPWKRVKNEPKVDIKNEASTSNPE-------------------------
-----PAMKEHVPE---------PL--------P--------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|15230726|ref|NP_189641.1|	   145 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------MENDGASTVCPLDLGSQMFLS-GD
GFEPASVLFPH------AAFHFPPKDKKEAYDFMDK--------------RLGLKSLPLE
ARIARVERK-VRAMESDHFQSNWR----------------KVRGQDPDYASDLPPCPWSS
PSEEDDEEEDSNHWKRVKNEPEVDDKNEASTSNAD-------------------------
-----PAMK---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|145334193|ref|NP_001078477.1|	   130 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MLRY--YD
ERRSDIARK-MAMLESHPRHWLKNGFQLLAPMPDVLLSYCE-------------------
----------------------------------------------------------DC
DRDAAAVSKEKNPTIIADGNFIPRTPSLFYL---------GPAATDADTTECQNFVNQVG
FLHQDQCRELQYFRTKKRSG----------------------------------------
------------------------------------------------------------
-------LSSRRARNSDC-
>gi|15225081|ref|NP_178676.1|	   98 residues, 50 /line  unknown protein [Arabidopsis thaliana]
M-----------------------------------------------------------
------------------------------------QRIEG-------------------
------------------------------------------------------------
-----VT-----------------------------------------------------
------------------------------------------------------------
--PNYSLSCR--------------------------------------------------
-----------TWR-----------------------------------EEMRRMEAHPK
DWVCYGFDKVADIPLPLRKWCVEYDGSSPYFKPWPESSDSTGDGGADD-DFLWRVDDNPV
KNPPDTLFQ----------
>gi|15241947|ref|NP_198238.1|	   183 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------MESSRSSFF-VSKNVPT-FSNAEA
-IEREMPF------------STISESRR--------LFS-FEKV-----QRRGMRR--PS
TSDAEVT-----------------------------------------------------
------------------------------------------------------------
--ESQNLSTRYEPSILF-------F--LLYL---------DVYYLR------LSFSIQVG
FMHQDQFRELQYFRNKKRKVDSRPEELEAEVAKIRAKQKKVTARLDEFKQMVKALEILSE
DWEKVDLQLVWPM-----------------------------------------------
---PDRLLRDNHSVSNRAI
>gi|22331483|ref|NP_683635.1|	   154 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
----------------------------------------MKSPL-PGDMGPD-FVPAPR
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------DFVPGEVI-------WPGKFFG---------QTNLSNEMHDACQMFIQKVD
NQH-------QAYRRRHRQLLIKLQDLER---------------------GMRRLEAHPK
DWVRYGFDKVADIPLPLRRWCVEHDGSSPNWSFFAEPNPIEEDDEPDDGSYYWRVDEPPR
EYPPDSLFQ----------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.