FANDOM


In the plant Arabidopsis thaliana, At1g56000.1 is a gene model for the locus At1g56000.[1]

This gene model is classified by TAIR as "amine oxidase-related". It is located on chr1, region 20947814-20949766 FORWARD.

Physiological functionEdit

At1g56000.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g56000.1/Expression

Subcellular localizationEdit

At1g56000.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At1g56000.1 has 384 amino-acid residues and a molecular weight Mw = 41.480 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is -0.67, or -0.002 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g56000.1/Knockout

Protein interactionsEdit

At1g56000.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At1g56000.1 has 2 recognized domains:

  • Domain_0022_0050 Pyr_redox domain (PF00070, IPR001327) Description: Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region;Biological Process: electron transport (GO:0006118), Molecular Function: disulfide oxidoreductase activity (GO:0015036)
  • Domain_0022_0057 Pyr_redox_2 domain (PF07992, IPR013027) Description: FAD-dependent pyridine nucleotide-disulphide oxidoreductase_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g56000.1
MAATTISPAI RKQMSSVAVA MKVAVIGSGI SGAVCASTLA RNGVSVTIFD SGRGPGGRMS QRREIGEDGK ELMFDHGAPF FCVSNSDAMA LVHEWESRGF VSEWKQVFGS FDCASNKFLG IQQEGDAKKY VGVPGMNSIS KALCNESGVK SMFGTGIAKM EWLEEEIPWL LTDSKGENLG RFDGVVASDK NIVSPRFTQV TGLPPPLDLS LVPELATKLQ NIPVLPCFSL MLAFKEPLSS IPVKGLSFKN SEILSWAHCE STKPGRSTDS ERWILHSTPD YANSVIAKTG LQKLSSETLN KISEEMFKEF QCSGLVSSLP FFMKAHRWGS AFPAKSIAVE ERCLWDRNRN LAICGDFCVS PNVEGAILSG LAAASKLLQT SSCL
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.