FANDOM


In the plant Arabidopsis thaliana, At1g35540.1 is a gene model for the locus At1g35540.[1]

At1g35540.1/Header

Physiological functionEdit

At1g35540.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g35540.1/Expression

Subcellular localizationEdit

At1g35540.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

At1g35540.1/Biophysics_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g35540.1/Knockout

Protein interactionsEdit

At1g35540.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

At1g35540.1/Domains_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g35540.1
MESGNVVNTQ PELSGIIDGS KSYMYEQLWK LCAGPLCDIP KLGEKVYYFP QGHIELVEAS TREELNELQP ICDFPSKLQC RVIAIQLKVE NNSDETYAEI TLMPDTTQVV IPTQNQNQFR PLVNSFTKVL TASDTSVHGG FSVPKKHAIE CLPPLDMSQP LPTQEILAID LHGNQWRFRH IYRGTAQRHL LTIGWNAFTT SKKLVEGDVI VFVRGETGEL RVGIRRAGHQ QGNIPSSIVS IESMRHGIIA SAKHAFDNQC MFIVVYKPRS SQFIVSYDKF LDVVNNKFNV GSRFTMRFEG DDFSERRSFG TIIGVSDFSP HWKCSEWRSL EVQWDEFASF PRPNQVSPWD IEHLTPWSNV SRSSFLKNKR SREVNEIGSS SSHLLPPTLT QGQEIGQQSM ATPMNISLRY RDITEDAMTP SRLLMSYPVQ PMAKLNYNNV VTPIEENITT NAVASFRLFG VSLATPSVIK DPVEQIGLEI SRLTQEKKFG QSQILRSPTE IQSKQFSSTR TCTKVQMQGV TIGRAVDLSV LNGYDQLILE LEKLFDLKGQ LQARNQWEIA FTNNEEDKML VGEDPWPEFC NMVKKIFIYS KEEVKNLKSR KSLSS
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit