Wikia

Proteins Wiki

At1g27190.1

Talk0
47,932pages on
this wiki

In the plant Arabidopsis thaliana, At1g27190.1 is a gene model for the locus At1g27190.[1]

At1g27190.1/Header

Physiological functionEdit

At1g27190.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g27190.1/Expression

Subcellular localizationEdit

At1g27190.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

At1g27190.1/Biophysics_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g27190.1/Knockout

Protein interactionsEdit

At1g27190.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

At1g27190.1/Domains_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g27190.1
MKKIFITLLW LLFISSFLCS SSSAEDDVLC LQGLKNSLID PSSRLSSWSF PNSSASSICK LTGVSCWNEK ENRIISLQLQ SMQLAGEIPE SLKLCRSLQS LDLSGNDLSG SIPSQICSWL PYLVTLDLSG NKLGGSIPTQ IVECKFLNAL ILSDNKLSGS IPSQLSRLDR LRRLSLAGND LSGTIPSELA RFGGDDFSGN NGLCGKPLSR CGALNGRNLS IIIVAGVLGA VGSLCVGLVI FWWFFIREGS RKKKGYGAGK SKDDSDWIGL LRSHKLVQVT LFQKPIVKIK LGDLMAATNN FSSGNIDVSS RTGVSYKADL PDGSALAVKR LSACGFGEKQ FRSEMNKLGE LRHPNLVPLL GYCVVEDERL LVYKHMVNGT LFSQLHNGGL CDAVLDWPTR RAIGVGAAKG LAWLHHGCQP PYLHQFISSN VILLDDDFDA RITDYGLAKL VGSRDSNDSS FNNGDLGELG YVAPEYSSTM VASLKGDVYG FGIVLLELVT GQKPLSVING VEGFKGSLVD WVSQYLGTGR SKDAIDRSIC DKGHDEEILQ FLKIACSCVV SRPKERPTMI QVYESLKNMA DKHGVSEHYD EFPLVFNKQE A
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Advertisement | Your ad here

Around Wikia's network

Random Wiki