Fandom

Proteins Wiki

At1g19680.1

47,922pages on
this wiki
Add New Page
Talk0 Share

In the plant Arabidopsis thaliana, At1g19680.1 is a gene model for the locus At1g19680.[1]

This gene model is classified by TAIR as "protein binding / zinc ion binding". It is located on chr1, region 6805900-6807673 FORWARD.

Physiological functionEdit

At1g19680.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g19680.1/Expression

Subcellular localizationEdit

At1g19680.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At1g19680.1 has 444 amino-acid residues and a molecular weight Mw = 47.990 kDa.

The protein is relatively basic; at the physiological pH 7.4, its net charge is 14.44, or 0.033 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g19680.1/Knockout

Protein interactionsEdit

At1g19680.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At1g19680.1 has 1 recognized domains:

  • Domain_0296_0325 zf-C3HC4 domain (PF00097, IPR001841) Description: Zinc finger, RING-type;Molecular Function: protein binding (GO:0005515), Molecular Function: zinc ion binding (GO:0008270)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g19680.1
MGSVCCVAAK DRNVPSGAID NSVCSPSWSF RRDNRRRVAD EIKDSSNHNV GSRGIDIDKL SLGLERGPPS SETGGLATLG SQKSADSEMG TASMVTAPLA GTSLAIRSPS DVSLASPVRV EVKNIVDSSD IVSSVLPNPS SSTSVSDLPS AHTHSLPPRS TPSRRARGSP GQQLFRQVSD SQTLGLKSPN NYSTSEGRSS FVLSTCSNDT ATGSHFASSE GGWSINAFCE LVAQSQRERW SFDNEHLGSG RRRLSGCSSS RFSCSPSVDQ QTCGRCSKLL TERSPVARFD LPIPAVLACG HVYHAACLET MTNETEKYDP TCPICTETQV TKLSRKALKA EAELKATSYK RCKNRVVDSY VRSECEDLMF QNLGKREGKG LKMDPSSNTK GSTSKSFMKW HFGSVSTKWS KARDSTSKKS FWSRHSNKRL SHSFSSVEGL NQAT
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.