FANDOM


In the plant Arabidopsis thaliana, At1g17870.1 is a gene model for the locus At1g17870.[1]

This gene model is classified by TAIR as "S2P-like putative metalloprotease, also contain transmembrane helices near their C-termini and many of them, five of seven, contain a conserved zinc-binding motif HEXXH. Homolog of EGY1. Each of the EGY1 and EGY-like proteins share two additional highly conserved motifs, the previously reported NPDG motif (aa 442-454 in EGY1, Rudner et al., 1999) and a newly defined GNLR motif (aa 171-179 in EGY1). The GNLR motif is a novel signature motif unique to EGY1 and EGY-like proteins as well as other EGY1 orthologs found in cyanobacteria.". It is located on chr1, region 6150029-6152178 REVERSE.

Physiological functionEdit

At1g17870.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g17870.1/Expression

Subcellular localizationEdit

At1g17870.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At1g17870.1 has 573 amino-acid residues and a molecular weight Mw = 62.703 kDa.

The protein is relatively acidic; at the physiological pH 7.4, its net charge is -14.43, or -0.025 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g17870.1/Knockout

Protein interactionsEdit

At1g17870.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At1g17870.1 has no known domains._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g17870.1
MASLFVSTPS SSLTLKSCHS LHLRRFDRAE FSNFGKASVN QTTRSRHSLR CSAEDDRVRE PVNEAPSPVA LAEEQKEDHD NNNAPPSPES SEEEEEKKSK QQEMDWKTDE EFKKFMGNPS IEAAIKLEKT RTDRKLKELN KESNSENPII GIYNSLARDS LTKEKERLEK AEETFKALDL NKLKSCFGFD TFFATDVRRF GDGGIFIGNL RKPIDEVTPK LEAKLSEAAG RDVVVWFMEE RSNEITKQVC MVQPKAEIDL QFESTRLSTP WGYVSAIALC VTTFGTIALM SGFFLKPDAT FDDYIANVVP LFGGFLSILG VSEIATRVTA ARHGVKLSPS FLVPSNWTGC LGVMNNYESL LPNKKALFDI PVARTASAYL TSLLLAAAAF ISDGSFNGGD NALYIRPQFF DNNPLLSFVQ FVVGPYADDL GNVLPNAVEG VGVPVDPLAF AGLLGMVVTS LNLLPCGRLE GGRIAQAMFG RSTAAILSFT TSLLLGIGGL SGSVLCLAWG LFATFFRGGE ETPAKDEITP VGDDRFAWGI VLGLICFLTL FPNSGGTFST SFFNGPFFRG DDF
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit