Fandom

Proteins Wiki

At1g10760.1

47,922pages on
this wiki
Add New Page
Talk0 Share

In the plant Arabidopsis thaliana, At1g10760.1 is a gene model for the locus At1g10760.[1]

Also known as SOP1, SOP, SEX1, GWD1, and GWD, this gene model is classified by TAIR as "SEX1 (STARCH EXCESS 1)". It is located on chr1, region 3581211-3590044 REVERSE.

Physiological functionEdit

At1g10760.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g10760.1/Expression

Subcellular localizationEdit

At1g10760.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At1g10760.1 has 1399 amino-acid residues and a molecular weight Mw = 156.556 kDa.

The protein is relatively acidic; at the physiological pH 7.4, its net charge is -22.55, or -0.016 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g10760.1/Knockout

Protein interactionsEdit

At1g10760.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At1g10760.1 has 1 recognized domains:

  • Domain_1371_1397 PPDK_N domain (PF01326, IPR002192) Description: Pyruvate phosphate dikinase, PEP/pyruvate-binding;Molecular Function: ATP binding (GO:0005524), Molecular Function: kinase activity (GO:0016301), Biological Process: phosphorylation (GO:0016310)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g10760.1
MSNSVVHNLL NRGLIRPLNF EHQNKLNSSV YQTSTANPAL GKIGRSKLYG KGLKQAGRSL VTETGGRPLS FVPRAVLAMD PQAAEKFSLD GNIDLLVEVT STTVREVNIQ IAYTSDTLFL HWGAILDNKE NWVLPSRSPD RTQNFKNSAL RTPFVKSGGN SHLKLEIDDP AIHAIEFLIF DESRNKWYKN NGQNFHINLP TERNVKQNVS VPEDLVQIQA YLRWERKGKQ MYNPEKEKEE YEAARTELRE EMMRGASVED LRAKLLKKDN SNESPKSNGT SSSGREEKKK VSKQPERKKN YNTDKIQRKG RDLTKLIYKH VADFVEPESK SSSEPRSLTT LEIYAKAKEE QETTPVFSKK TFKLEGSAIL VFVTKLSGKT KIHVATDFKE PVTLHWALSQ KGGEWLDPPS DILPPNSLPV RGAVDTKLTI TSTDLPSPVQ TFELEIEGDS YKGMPFVLNA GERWIKNNDS DFYVDFAKEE KHVQKDYGDG KGTAKHLLDK IADLESEAQK SFMHRFNIAA DLVDEAKSAG QLGFAGILVW MRFMATRQLV WNKNYNVKPR EISKAQDRLT DLLQDVYASY PEYRELLRMI MSTVGRGGEG DVGQRIRDEI LVIQRKNDCK GGIMEEWHQK LHNNTSPDDV VICQALMDYI KSDFDLSVYW KTLNDNGITK ERLLSYDRAI HSEPNFRGEQ KDGLLRDLGH YMRTLKAVHS GADLESAIQN CMGYQDDGEG FMVGVQINPV SGLPSGYPDL LRFVLEHVEE KNVEPLLEGL LEARQELRPL LLKSHDRLKD LLFLDLALDS TVRTAIERGY EQLNDAGPEK IMYFISLVLE NLALSSDDNE DLIYCLKGWQ FALDMCKSKK DHWALYAKSV LDRSRLALAS KAERYLEILQ PSAEYLGSCL GVDQSAVSIF TEEIIRAGSA AALSSLVNRL DPVLRKTANL GSWQVISPVE VVGYVIVVDE LLTVQNKTYD RPTIIVANRV RGEEEIPDGA VAVLTPDMPD VLSHVSVRAR NGKICFATCF DSGILSDLQG KDGKLLSLQP TSADVVYKEV NDSELSSPSS DNLEDAPPSI SLVKKQFAGR YAISSEEFTS DLVGAKSRNI GYLKGKVPSW VGIPTSVALP FGVFEKVISE KANQAVNDKL LVLKKTLDEG DQGALKEIRQ TLLGLVAPPE LVEELKSTMK SSDMPWPGDE GEQRWEQAWA AIKKVWASKW NERAYFSTRK VKLDHDYLCM AVLVQEVINA DYAFVIHTTN PSSGDSSEIY AEVVKGLGET LVGAYPGRSL SFICKKNNLD SPLVLGYPSK PIGLFIRRSI IFRSDSNGED LEGYAGAGLY DSVPMDEEDQ VVLDYTTDPL ITDLSFQKKV LSDIARAGDA IEKLYGTAQD IEGVIRDGKL YVVQTRPQV
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.