Wikia

Proteins Wiki

At1g07150.1

Talk0
47,932pages on
this wiki

In the plant Arabidopsis thaliana, At1g07150.1 is a gene model for the locus At1g07150.[1]

Also known as MAPKKK13, this gene model is classified by TAIR as "MAPKKK13 (Mitogen-activated protein kinase kinase kinase 13); kinase". It is located on chr1, region 2194278-2195777 REVERSE.

Physiological functionEdit

At1g07150.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g07150.1/Expression

Subcellular localizationEdit

At1g07150.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At1g07150.1 has 499 amino-acid residues and a molecular weight Mw = 55.537 kDa.

The protein is relatively acidic; at the physiological pH 7.4, its net charge is -19.11, or -0.038 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g07150.1/Knockout

Protein interactionsEdit

At1g07150.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At1g07150.1 has 1 recognized domains:

  • Domain_0023_0279 Pkinase domain (PF00069, IPR000719) Description: Protein kinase;Molecular Function: protein kinase activity (GO:0004672), Molecular Function: ATP binding (GO:0005524), Biological Process: protein amino acid phosphorylation (GO:0006468)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g07150.1
MEKQSIRNTC SSSLMLSSPS SFWVRGACIG RGCFGAVSTA ISKTNGEVFA VKSVDLATSL PTQSESLENE ISVFRSLKPH PYIVKFLGDG VSKEGTTTFR NLYLEYLPNG DVASHRAGGK IEDETLLQRY TACLVSALRH VHSQGFVHCD VKARNILVSQ SSMVKLADFG SAFRIHTPRA LITPRGSPLW MAPEVIRREY QGPESDVWSL GCTIIEMFTG KPAWEDHGID SLSRISFSDE LPVFPSKLSE IGRDFLEKCL KRDPNQRWSC DQLLQHPFLS QCHNSSPTES SPRCVLDWVN SGFDLEEEEE EVGRSEFEDA AKAIICNLAT TGGVIWESDG WVEVRCHASE EEGTTMEYSG STRVESEYNT SSDPNDDVAG DSAIIDVSMS QNLPPGNGGS AAALPYEFVV VLHLLMEIMV YTTCIFREIV LTMYLLYQYN QSNKLETLSF NHSLKFCLFA HVIRIGQNYL LRGEMRSSVL ITSHCLILIT LVYSQIVVF
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Advertisement | Your ad here

Around Wikia's network

Random Wiki