Wikia

Proteins Wiki

At1g07010.1

Talk0
47,932pages on
this wiki

In the plant Arabidopsis thaliana, At1g07010.1 is a gene model for the locus At1g07010.[1]

This gene model is classified by TAIR as "calcineurin-like phosphoesterase family protein". It is located on chr1, region 2152948-2154967 FORWARD.

Physiological functionEdit

At1g07010.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g07010.1/Expression

Subcellular localizationEdit

At1g07010.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At1g07010.1 has 389 amino-acid residues and a molecular weight Mw = 43.720 kDa.

The protein is relatively acidic; at the physiological pH 7.4, its net charge is -11.44, or -0.029 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g07010.1/Knockout

Protein interactionsEdit

At1g07010.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At1g07010.1 has 1 recognized domains:

  • Domain_0057_0333 Metallophos domain (PF00149, IPR004843) Description: Metallophosphoesterase;Molecular Function: hydrolase activity (GO:0016787)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g07010.1
MASLYLNSLL PLPPSHPQKL LEPSSSSLLS TSNGNELALK PIVINGDPPT FVSAPARRIV AVGDLHGDLG KARDALQLAG VLSSDGRDQW VGQDTVLVQV GDILDRGDDE IAILSLLRSL DDQAKANGGA VFQVNGNHET MNVEGDFRYV DARAFDECTD FLDYLEDYAQ DWDKAFRNWI FESRQWKEDR RSSQTYWDQW NVVKRQKGVI ARSVLLRPGG RLACELSRHG VILRVNNWLF CHGGLLPHHV AYGIERINRE VSTWMRSPTN YEDSPQMPFI ATRGYDSVVW SRLYSRETSE LEDYQIEQVN KILHDTLEAV GAKAMVVGHT PQLSGVNCEY GCGIWRVDVG MSSGVLDSRP EVLEIRGDKA RVIRSNRDRL HELQVADYI
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Around Wikia's network

Random Wiki