Wikia

Proteins Wiki

At1g05530.1

Talk0
47,932pages on
this wiki

In the plant Arabidopsis thaliana, At1g05530.1 is a gene model for the locus At1g05530.[1]

Also known as UGT75B2, and UGT2, this gene model is classified by TAIR as "UGT2/UGT75B2 (UDP-glucosyl transferase 75B2); UDP-glucosyltransferase/ UDP-glycosyltransferase/ abscisic acid glucosyltransferase/ transferase, transferring glycosyl groups". It is located on chr1, region 1636495-1637862 REVERSE.

Physiological functionEdit

At1g05530.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g05530.1/Expression

Subcellular localizationEdit

At1g05530.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At1g05530.1 has 455 amino-acid residues and a molecular weight Mw = 51.171 kDa.

The protein is relatively acidic; at the physiological pH 7.4, its net charge is -17.43, or -0.038 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g05530.1/Knockout

Protein interactionsEdit

At1g05530.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At1g05530.1 has 1 recognized domains:

  • Domain_0260_0388 UDPGT domain (PF00201, IPR002213) Description: UDP-glucuronosyl/UDP-glucosyltransferase;Biological Process: metabolism (GO:0008152), Molecular Function: transferase activity, transferring hexosyl groups (GO:0016758)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g05530.1
MAQPHFLLVT FPAQGHVNPS LRFARRLIKT TGARVTFATC LSVIHRSMIP NHNNVENLSF LTFSDGFDDG VISNTDDVQN RLVHFERNGD KALSDFIEAN QNGDSPVSCL IYTILPNWVP KVARRFHLPS VHLWIQPAFA FDIYYNYSTG NNSVFEFPNL PSLEIRDLPS FLSPSNTNKA AQAVYQELMD FLKEESNPKI LVNTFDSLEP EFLTAIPNIE MVAVGPLLPA EIFTGSESGK DLSRDHQSSS YTLWLDSKTE SSVIYVSFGT MVELSKKQIE ELARALIEGG RPFLWVITDK LNREAKIEGE EETEIEKIAG FRHELEEVGM IVSWCSQIEV LRHRAIGCFL THCGWSSSLE SLVLGVPVVA FPMWSDQPAN AKLLEEIWKT GVRVRENSEG LVERGEIMRC LEAVMEAKSV ELRENAEKWK RLATEAGREG GSSDKNVEAF VKSLF
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Advertisement | Your ad here

Around Wikia's network

Random Wiki